Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6YT05

Protein Details
Accession W6YT05    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-30QDDAKRFPCKYCKKYRGSNGFKRRDHLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013087  Znf_C2H2_type  
KEGG bze:COCCADRAFT_61878  -  
Amino Acid Sequences RKHQDDAKRFPCKYCKKYRGSNGFKRRDHLTQHVRSYHHIGENDGDKYGTYGSYWCPKIECIHHKESPYGFGNWGAFSALAEYIKHMRNVHDESDFPCPQPGCDRVDSKGYFRKADLRNHLRKVHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.76
3 0.75
4 0.83
5 0.87
6 0.88
7 0.87
8 0.88
9 0.87
10 0.87
11 0.82
12 0.75
13 0.7
14 0.65
15 0.61
16 0.61
17 0.6
18 0.58
19 0.62
20 0.63
21 0.59
22 0.56
23 0.55
24 0.48
25 0.43
26 0.36
27 0.3
28 0.28
29 0.3
30 0.27
31 0.22
32 0.18
33 0.13
34 0.13
35 0.12
36 0.09
37 0.06
38 0.06
39 0.08
40 0.14
41 0.15
42 0.15
43 0.15
44 0.16
45 0.19
46 0.25
47 0.3
48 0.3
49 0.35
50 0.38
51 0.38
52 0.4
53 0.37
54 0.35
55 0.3
56 0.25
57 0.19
58 0.18
59 0.17
60 0.15
61 0.14
62 0.1
63 0.07
64 0.06
65 0.07
66 0.06
67 0.06
68 0.06
69 0.07
70 0.11
71 0.13
72 0.16
73 0.16
74 0.17
75 0.23
76 0.27
77 0.28
78 0.26
79 0.25
80 0.25
81 0.32
82 0.31
83 0.25
84 0.26
85 0.24
86 0.23
87 0.28
88 0.28
89 0.25
90 0.3
91 0.32
92 0.3
93 0.39
94 0.39
95 0.4
96 0.45
97 0.44
98 0.41
99 0.4
100 0.47
101 0.45
102 0.53
103 0.58
104 0.6
105 0.66
106 0.72