Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2W647

Protein Details
Accession B2W647    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
42-75SIPLSPRTPKRKPCRPSPPKRAKQSPPKSTKPTTHydrophilic
NLS Segment(s)
PositionSequence
48-70RTPKRKPCRPSPPKRAKQSPPKS
Subcellular Location(s) mito 14, nucl 8.5, cyto_nucl 6, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MLVFSSPRCDSLLPRGPGKQTSFLSARLSLPLLLWSTQTPASIPLSPRTPKRKPCRPSPPKRAKQSPPKSTKPTTPSTTDMSHHPGTPRSATFSPTLGSIPEVFEYDSLDAQFGSASLNDAPETPEAFLPETSSMSPPTLTRATSWPAIIQSPSRRVASPFAVSKALRRILEADRARRRRIMRVYLKAIVFLKYLWRANERYGNVMVTTGMYMQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.47
4 0.52
5 0.52
6 0.49
7 0.41
8 0.43
9 0.41
10 0.4
11 0.4
12 0.36
13 0.33
14 0.27
15 0.27
16 0.2
17 0.18
18 0.18
19 0.16
20 0.14
21 0.14
22 0.12
23 0.14
24 0.15
25 0.14
26 0.12
27 0.13
28 0.16
29 0.19
30 0.2
31 0.21
32 0.27
33 0.31
34 0.39
35 0.46
36 0.52
37 0.58
38 0.67
39 0.73
40 0.73
41 0.8
42 0.83
43 0.85
44 0.87
45 0.88
46 0.89
47 0.89
48 0.92
49 0.91
50 0.89
51 0.89
52 0.89
53 0.88
54 0.85
55 0.84
56 0.82
57 0.76
58 0.74
59 0.68
60 0.64
61 0.58
62 0.54
63 0.48
64 0.45
65 0.43
66 0.37
67 0.34
68 0.33
69 0.29
70 0.27
71 0.25
72 0.23
73 0.23
74 0.24
75 0.22
76 0.21
77 0.21
78 0.21
79 0.21
80 0.19
81 0.17
82 0.16
83 0.15
84 0.1
85 0.1
86 0.08
87 0.08
88 0.07
89 0.07
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.06
96 0.06
97 0.05
98 0.05
99 0.05
100 0.04
101 0.04
102 0.03
103 0.04
104 0.04
105 0.05
106 0.05
107 0.05
108 0.07
109 0.07
110 0.08
111 0.08
112 0.08
113 0.08
114 0.09
115 0.09
116 0.09
117 0.09
118 0.1
119 0.1
120 0.1
121 0.1
122 0.1
123 0.11
124 0.1
125 0.13
126 0.14
127 0.13
128 0.14
129 0.16
130 0.19
131 0.19
132 0.2
133 0.17
134 0.16
135 0.17
136 0.17
137 0.19
138 0.21
139 0.25
140 0.28
141 0.28
142 0.28
143 0.29
144 0.32
145 0.31
146 0.31
147 0.28
148 0.28
149 0.3
150 0.3
151 0.32
152 0.34
153 0.35
154 0.3
155 0.29
156 0.3
157 0.3
158 0.39
159 0.42
160 0.45
161 0.51
162 0.56
163 0.58
164 0.61
165 0.61
166 0.61
167 0.64
168 0.65
169 0.64
170 0.67
171 0.71
172 0.7
173 0.66
174 0.61
175 0.54
176 0.44
177 0.35
178 0.26
179 0.26
180 0.26
181 0.29
182 0.29
183 0.32
184 0.33
185 0.39
186 0.47
187 0.43
188 0.41
189 0.4
190 0.37
191 0.32
192 0.3
193 0.24
194 0.16
195 0.15