Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6Y993

Protein Details
Accession W6Y993    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-38ETRCQAKEARKACNRKAQRRYREKLKMKKITSYAHydrophilic
NLS Segment(s)
PositionSequence
19-32RKAQRRYREKLKMK
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 5
Family & Domain DBs
KEGG bze:COCCADRAFT_111159  -  
Amino Acid Sequences NWKYETRCQAKEARKACNRKAQRRYREKLKMKKITSYASPSDSTTRDEIEEEPPTAVDPPGADAQEVSTGMEDVSNQRREPDPPSISLTLLERVARIEQDVDRLLVSVEDLNVKKSLQSPIARVNPKFKDLVSRVYQGQQQPAVPQKPSVVPRMHYNPHASTGNPAQGLWPCFACLPPGYADVEMSKKVPYGAIPVFSHRPILHCITPSSSCTRLRCDTEEQGIPDGQHPLNFQYTWRVEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.74
3 0.77
4 0.79
5 0.8
6 0.82
7 0.86
8 0.87
9 0.88
10 0.9
11 0.91
12 0.91
13 0.92
14 0.91
15 0.91
16 0.91
17 0.9
18 0.83
19 0.82
20 0.77
21 0.71
22 0.67
23 0.63
24 0.56
25 0.49
26 0.47
27 0.4
28 0.39
29 0.35
30 0.32
31 0.27
32 0.24
33 0.21
34 0.22
35 0.21
36 0.22
37 0.23
38 0.2
39 0.19
40 0.17
41 0.17
42 0.16
43 0.14
44 0.1
45 0.07
46 0.09
47 0.11
48 0.12
49 0.11
50 0.1
51 0.1
52 0.12
53 0.12
54 0.09
55 0.07
56 0.07
57 0.07
58 0.07
59 0.06
60 0.09
61 0.16
62 0.19
63 0.19
64 0.21
65 0.23
66 0.25
67 0.29
68 0.33
69 0.28
70 0.28
71 0.33
72 0.32
73 0.3
74 0.29
75 0.25
76 0.18
77 0.17
78 0.15
79 0.1
80 0.1
81 0.11
82 0.1
83 0.09
84 0.09
85 0.09
86 0.11
87 0.11
88 0.11
89 0.1
90 0.1
91 0.09
92 0.07
93 0.07
94 0.05
95 0.05
96 0.08
97 0.08
98 0.09
99 0.1
100 0.1
101 0.1
102 0.13
103 0.15
104 0.17
105 0.18
106 0.2
107 0.27
108 0.34
109 0.37
110 0.36
111 0.41
112 0.37
113 0.38
114 0.36
115 0.28
116 0.29
117 0.27
118 0.33
119 0.29
120 0.29
121 0.29
122 0.3
123 0.34
124 0.27
125 0.28
126 0.23
127 0.2
128 0.21
129 0.27
130 0.27
131 0.23
132 0.23
133 0.22
134 0.25
135 0.28
136 0.3
137 0.26
138 0.25
139 0.31
140 0.37
141 0.38
142 0.36
143 0.38
144 0.33
145 0.35
146 0.34
147 0.28
148 0.25
149 0.25
150 0.26
151 0.21
152 0.2
153 0.17
154 0.19
155 0.21
156 0.18
157 0.15
158 0.13
159 0.13
160 0.13
161 0.13
162 0.1
163 0.11
164 0.11
165 0.12
166 0.13
167 0.13
168 0.14
169 0.14
170 0.16
171 0.15
172 0.14
173 0.13
174 0.12
175 0.12
176 0.12
177 0.11
178 0.15
179 0.16
180 0.2
181 0.21
182 0.25
183 0.28
184 0.28
185 0.31
186 0.25
187 0.26
188 0.26
189 0.31
190 0.29
191 0.28
192 0.29
193 0.3
194 0.32
195 0.32
196 0.33
197 0.33
198 0.35
199 0.36
200 0.41
201 0.43
202 0.46
203 0.48
204 0.5
205 0.51
206 0.51
207 0.53
208 0.48
209 0.45
210 0.41
211 0.37
212 0.32
213 0.31
214 0.25
215 0.23
216 0.22
217 0.22
218 0.25
219 0.24
220 0.24
221 0.28