Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YCD9

Protein Details
Accession W6YCD9    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
87-112DEDFFNPGKERKKPRKKDSDTNAGAAHydrophilic
NLS Segment(s)
PositionSequence
93-103PGKERKKPRKK
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
KEGG bze:COCCADRAFT_30001  -  
Amino Acid Sequences MPHKTKTRHHCSGQNGWVGDISPGNCNKSGNGSHCTKHQMLCEGGCGAWHLKNQSGCQQSIARKEAEERRQRAERQRLKEEEEKSKDEDFFNPGKERKKPRKKDSDTNAGAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.59
3 0.51
4 0.44
5 0.37
6 0.3
7 0.22
8 0.17
9 0.15
10 0.17
11 0.19
12 0.2
13 0.2
14 0.19
15 0.22
16 0.26
17 0.25
18 0.28
19 0.3
20 0.3
21 0.33
22 0.38
23 0.34
24 0.32
25 0.3
26 0.29
27 0.27
28 0.26
29 0.24
30 0.19
31 0.17
32 0.14
33 0.13
34 0.1
35 0.1
36 0.11
37 0.11
38 0.13
39 0.16
40 0.17
41 0.23
42 0.24
43 0.23
44 0.24
45 0.27
46 0.28
47 0.31
48 0.32
49 0.25
50 0.22
51 0.28
52 0.33
53 0.38
54 0.43
55 0.41
56 0.46
57 0.51
58 0.56
59 0.61
60 0.64
61 0.63
62 0.63
63 0.68
64 0.65
65 0.66
66 0.68
67 0.64
68 0.63
69 0.6
70 0.55
71 0.5
72 0.5
73 0.45
74 0.4
75 0.36
76 0.31
77 0.29
78 0.31
79 0.33
80 0.35
81 0.41
82 0.48
83 0.57
84 0.62
85 0.71
86 0.77
87 0.82
88 0.88
89 0.9
90 0.92
91 0.91
92 0.91
93 0.83
94 0.75