Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Y1A7

Protein Details
Accession W6Y1A7   
Localization Confidence High
Confidence Score 26.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-22SSMRNAVQRRNHKERAQPLERHydrophilic
28-48LEKRKDYKLRAADHREKKAKLBasic
206-227EEQARREARKFRKDRERALERTBasic
NLS Segment(s)
PositionSequence
14-52KERAQPLEREKWGLLEKRKDYKLRAADHREKKAKLKILS
209-237ARREARKFRKDRERALERTASKLQGIKKR
270-276KVRERKR
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007144  SSU_processome_Utp11  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0006364  P:rRNA processing  
KEGG bze:COCCADRAFT_108206  -  
Pfam View protein in Pfam  
PF03998  Utp11  
Amino Acid Sequences MSSMRNAVQRRNHKERAQPLEREKWGLLEKRKDYKLRAADHREKKAKLKILSQKARDRNPDEFSFKMMSSQVDKNGRKVADRGNKALSVDVVKLLKTQDAGYIRTMLQVTRKEREELEKKLVMEEQGEVRAMKDGEEAKHGKHRVFVENEEEQEEFDPDAWFGRGEKIPSRVDSPTFGDLQDESEEDEEQTIQRPKTLSKKQAEAEEQARREARKFRKDRERALERTASKLQGIKKRERELMAAEEELELQRAKMNNTVGGVNKNGVKFKVRERKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.81
3 0.82
4 0.79
5 0.78
6 0.77
7 0.78
8 0.73
9 0.68
10 0.58
11 0.54
12 0.53
13 0.52
14 0.53
15 0.53
16 0.58
17 0.62
18 0.69
19 0.7
20 0.67
21 0.69
22 0.69
23 0.67
24 0.7
25 0.71
26 0.74
27 0.77
28 0.83
29 0.81
30 0.76
31 0.76
32 0.74
33 0.73
34 0.67
35 0.67
36 0.67
37 0.7
38 0.75
39 0.75
40 0.76
41 0.76
42 0.79
43 0.78
44 0.74
45 0.69
46 0.66
47 0.63
48 0.59
49 0.51
50 0.47
51 0.4
52 0.34
53 0.3
54 0.25
55 0.21
56 0.21
57 0.23
58 0.27
59 0.34
60 0.35
61 0.37
62 0.41
63 0.4
64 0.37
65 0.38
66 0.41
67 0.41
68 0.44
69 0.44
70 0.41
71 0.42
72 0.4
73 0.37
74 0.28
75 0.21
76 0.17
77 0.16
78 0.13
79 0.12
80 0.13
81 0.13
82 0.12
83 0.11
84 0.11
85 0.13
86 0.15
87 0.17
88 0.17
89 0.18
90 0.17
91 0.18
92 0.18
93 0.14
94 0.17
95 0.22
96 0.25
97 0.27
98 0.29
99 0.29
100 0.3
101 0.38
102 0.39
103 0.37
104 0.39
105 0.38
106 0.36
107 0.35
108 0.35
109 0.26
110 0.21
111 0.17
112 0.12
113 0.1
114 0.1
115 0.09
116 0.08
117 0.1
118 0.09
119 0.08
120 0.09
121 0.11
122 0.11
123 0.16
124 0.16
125 0.16
126 0.22
127 0.23
128 0.21
129 0.24
130 0.26
131 0.27
132 0.29
133 0.29
134 0.28
135 0.29
136 0.29
137 0.26
138 0.23
139 0.18
140 0.15
141 0.14
142 0.09
143 0.08
144 0.07
145 0.06
146 0.07
147 0.07
148 0.06
149 0.06
150 0.1
151 0.1
152 0.12
153 0.15
154 0.2
155 0.21
156 0.23
157 0.25
158 0.23
159 0.23
160 0.24
161 0.24
162 0.22
163 0.21
164 0.19
165 0.17
166 0.15
167 0.16
168 0.14
169 0.1
170 0.09
171 0.09
172 0.09
173 0.09
174 0.09
175 0.07
176 0.07
177 0.12
178 0.16
179 0.15
180 0.17
181 0.18
182 0.23
183 0.33
184 0.42
185 0.46
186 0.46
187 0.53
188 0.54
189 0.6
190 0.59
191 0.55
192 0.53
193 0.52
194 0.47
195 0.45
196 0.45
197 0.39
198 0.39
199 0.43
200 0.46
201 0.49
202 0.56
203 0.62
204 0.7
205 0.76
206 0.82
207 0.83
208 0.82
209 0.76
210 0.75
211 0.73
212 0.63
213 0.62
214 0.56
215 0.47
216 0.41
217 0.41
218 0.42
219 0.41
220 0.47
221 0.5
222 0.55
223 0.6
224 0.64
225 0.62
226 0.58
227 0.55
228 0.54
229 0.47
230 0.39
231 0.32
232 0.26
233 0.25
234 0.21
235 0.18
236 0.12
237 0.09
238 0.13
239 0.14
240 0.16
241 0.2
242 0.22
243 0.23
244 0.24
245 0.28
246 0.27
247 0.28
248 0.28
249 0.27
250 0.29
251 0.29
252 0.31
253 0.3
254 0.33
255 0.34
256 0.43