Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6Y2E5

Protein Details
Accession W6Y2E5    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
39-58ISKLRCNRNNAKRANLRNFPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, mito_nucl 14, mito 9.5
Family & Domain DBs
KEGG bze:COCCADRAFT_99532  -  
Amino Acid Sequences MTPLRSRTIPSNPRYVLQQYKLKPRPMRTIDGRRNPISISKLRCNRNNAKRANLRNFPNW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.47
4 0.45
5 0.49
6 0.45
7 0.54
8 0.59
9 0.63
10 0.63
11 0.61
12 0.64
13 0.61
14 0.63
15 0.61
16 0.65
17 0.66
18 0.69
19 0.69
20 0.6
21 0.56
22 0.5
23 0.45
24 0.4
25 0.37
26 0.35
27 0.39
28 0.46
29 0.52
30 0.58
31 0.62
32 0.67
33 0.72
34 0.74
35 0.71
36 0.73
37 0.76
38 0.8
39 0.81
40 0.78