Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6YHS0

Protein Details
Accession W6YHS0    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
54-82INYQKRRQTIHNPCFHKKRREGEKRRERQBasic
NLS Segment(s)
PositionSequence
70-82KKRREGEKRRERQ
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
KEGG bze:COCCADRAFT_91590  -  
Amino Acid Sequences TVTTTTTTTKNTLFANLIFSFSFLCSYQKKLAHTWIKGSFLPKNPQKFVTVQKINYQKRRQTIHNPCFHKKRREGEKRRERQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.22
4 0.22
5 0.19
6 0.18
7 0.16
8 0.14
9 0.15
10 0.1
11 0.13
12 0.13
13 0.17
14 0.23
15 0.26
16 0.28
17 0.28
18 0.37
19 0.41
20 0.41
21 0.42
22 0.39
23 0.39
24 0.38
25 0.38
26 0.33
27 0.3
28 0.37
29 0.36
30 0.39
31 0.38
32 0.38
33 0.38
34 0.37
35 0.39
36 0.41
37 0.41
38 0.37
39 0.43
40 0.52
41 0.57
42 0.63
43 0.65
44 0.6
45 0.63
46 0.67
47 0.67
48 0.68
49 0.71
50 0.71
51 0.72
52 0.74
53 0.75
54 0.8
55 0.82
56 0.81
57 0.78
58 0.79
59 0.81
60 0.85
61 0.88
62 0.88