Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6Y9C0

Protein Details
Accession W6Y9C0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-36RALIPRHPGRCRRRREMLRARALIBasic
NLS Segment(s)
PositionSequence
20-31PGRCRRRREMLR
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
KEGG bze:COCCADRAFT_36172  -  
Amino Acid Sequences MTVPEPSEAVKLRALIPRHPGRCRRRREMLRARALISRGPQSPEIGRASRARQLTGAATNPPGCLQPDLAAISQGAAIGSRPSDEMLLRPSGSNSGTKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.36
4 0.44
5 0.49
6 0.55
7 0.61
8 0.66
9 0.73
10 0.78
11 0.77
12 0.79
13 0.81
14 0.84
15 0.85
16 0.85
17 0.85
18 0.78
19 0.72
20 0.64
21 0.56
22 0.47
23 0.38
24 0.32
25 0.24
26 0.24
27 0.23
28 0.21
29 0.21
30 0.22
31 0.23
32 0.19
33 0.2
34 0.2
35 0.22
36 0.24
37 0.24
38 0.21
39 0.18
40 0.19
41 0.18
42 0.17
43 0.17
44 0.13
45 0.14
46 0.14
47 0.13
48 0.13
49 0.12
50 0.11
51 0.1
52 0.1
53 0.1
54 0.11
55 0.13
56 0.12
57 0.12
58 0.11
59 0.1
60 0.09
61 0.08
62 0.06
63 0.04
64 0.05
65 0.05
66 0.05
67 0.06
68 0.06
69 0.07
70 0.09
71 0.09
72 0.11
73 0.14
74 0.17
75 0.17
76 0.17
77 0.18
78 0.2
79 0.21
80 0.22