Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YLS3

Protein Details
Accession W6YLS3    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-22LPYARKPKNKVVESRTRKTLHydrophilic
108-134ASVAKRKQACTSCRQRKKKCDVRVMMYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto_nucl 2, nucl 1.5, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0016020  C:membrane  
GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG bze:COCCADRAFT_87621  -  
CDD cd00067  GAL4  
Amino Acid Sequences LLLPYARKPKNKVVESRTRKTLLIATLNGLLHMIGSYLLRYALRPPEMQIRFNSELTHPSLAAPRTRHMIPLYFPLRFSWPSYQSETLGSHVQILGLPATMVTLTIPASVAKRKQACTSCRQRKKKCDVRVMMY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.8
4 0.77
5 0.69
6 0.62
7 0.54
8 0.5
9 0.45
10 0.41
11 0.34
12 0.29
13 0.3
14 0.29
15 0.27
16 0.22
17 0.15
18 0.1
19 0.09
20 0.07
21 0.04
22 0.04
23 0.04
24 0.04
25 0.05
26 0.06
27 0.06
28 0.1
29 0.14
30 0.16
31 0.17
32 0.19
33 0.28
34 0.3
35 0.32
36 0.3
37 0.33
38 0.33
39 0.33
40 0.33
41 0.23
42 0.24
43 0.24
44 0.24
45 0.16
46 0.13
47 0.16
48 0.16
49 0.19
50 0.18
51 0.16
52 0.19
53 0.19
54 0.2
55 0.18
56 0.19
57 0.16
58 0.23
59 0.24
60 0.21
61 0.21
62 0.2
63 0.22
64 0.22
65 0.24
66 0.22
67 0.23
68 0.25
69 0.3
70 0.3
71 0.28
72 0.29
73 0.26
74 0.23
75 0.21
76 0.18
77 0.14
78 0.13
79 0.12
80 0.1
81 0.09
82 0.07
83 0.05
84 0.05
85 0.04
86 0.05
87 0.04
88 0.04
89 0.03
90 0.04
91 0.04
92 0.05
93 0.05
94 0.06
95 0.09
96 0.15
97 0.17
98 0.25
99 0.3
100 0.33
101 0.41
102 0.48
103 0.52
104 0.57
105 0.66
106 0.69
107 0.75
108 0.83
109 0.85
110 0.88
111 0.93
112 0.93
113 0.92
114 0.91