Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6YLL3

Protein Details
Accession W6YLL3    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
58-83GSGKSRNPRGDPRRKGKLKSMQPHGABasic
NLS Segment(s)
PositionSequence
61-76KSRNPRGDPRRKGKLK
Subcellular Location(s) mito 18, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
KEGG bze:COCCADRAFT_82395  -  
Amino Acid Sequences MRLSAAVYILPGVTASDGVMLLAYLPITRREPVVYTGELVQKVPIRSQLGATVGMVLGSGKSRNPRGDPRRKGKLKSMQPHGAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.03
12 0.05
13 0.07
14 0.09
15 0.1
16 0.11
17 0.12
18 0.14
19 0.16
20 0.19
21 0.17
22 0.16
23 0.18
24 0.19
25 0.18
26 0.17
27 0.15
28 0.15
29 0.15
30 0.14
31 0.16
32 0.15
33 0.15
34 0.16
35 0.16
36 0.15
37 0.15
38 0.14
39 0.11
40 0.08
41 0.08
42 0.07
43 0.05
44 0.04
45 0.05
46 0.05
47 0.07
48 0.13
49 0.18
50 0.22
51 0.28
52 0.39
53 0.49
54 0.6
55 0.68
56 0.72
57 0.79
58 0.82
59 0.82
60 0.81
61 0.81
62 0.81
63 0.81
64 0.81