Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YLE8

Protein Details
Accession W6YLE8   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
58-82LSGPVTPRKKTGRPKKKPASEEEVQHydrophilic
NLS Segment(s)
PositionSequence
64-75PRKKTGRPKKKP
Subcellular Location(s) nucl 13, cyto_nucl 12, cyto 9, mito 4
Family & Domain DBs
KEGG bze:COCCADRAFT_34190  -  
Amino Acid Sequences MEQPCPLIEQPGTPKHRRTTPLSRDDRLRIHTLWKAGHKQQWIADHLGFKLRQVTYVLSGPVTPRKKTGRPKKKPASEEEVQELRDGLQNLNSRLLELKQGVRGPSNGQKSIKNGPESFNGKAQGINNGLQHVEHQPQNVQQVPQQVYHGHHLPGHISQVPQPVHRHGIPGQVHQLPQHPHQVLPQNLHQVPQHIHQAPQHIHPVPQPIHKAPHQIYQAPQQVHQLSQNVPQGPPRNSRNWKKTPEVQEPQISGDEESQDTAIETPSNVVDKGLDTKCVDREQEHAVQKEQKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.57
3 0.65
4 0.64
5 0.65
6 0.67
7 0.7
8 0.75
9 0.76
10 0.74
11 0.73
12 0.73
13 0.71
14 0.65
15 0.6
16 0.5
17 0.49
18 0.48
19 0.46
20 0.45
21 0.47
22 0.49
23 0.51
24 0.56
25 0.53
26 0.53
27 0.52
28 0.53
29 0.49
30 0.45
31 0.41
32 0.37
33 0.34
34 0.36
35 0.32
36 0.26
37 0.29
38 0.25
39 0.24
40 0.24
41 0.25
42 0.22
43 0.25
44 0.24
45 0.18
46 0.18
47 0.19
48 0.26
49 0.28
50 0.26
51 0.3
52 0.37
53 0.45
54 0.56
55 0.64
56 0.67
57 0.73
58 0.83
59 0.88
60 0.9
61 0.88
62 0.84
63 0.81
64 0.74
65 0.67
66 0.63
67 0.54
68 0.45
69 0.39
70 0.31
71 0.24
72 0.23
73 0.2
74 0.13
75 0.16
76 0.2
77 0.21
78 0.24
79 0.23
80 0.2
81 0.2
82 0.21
83 0.18
84 0.17
85 0.18
86 0.18
87 0.2
88 0.21
89 0.21
90 0.21
91 0.22
92 0.27
93 0.3
94 0.31
95 0.31
96 0.32
97 0.35
98 0.41
99 0.42
100 0.4
101 0.36
102 0.34
103 0.39
104 0.4
105 0.38
106 0.33
107 0.29
108 0.25
109 0.26
110 0.24
111 0.21
112 0.2
113 0.2
114 0.17
115 0.17
116 0.16
117 0.14
118 0.15
119 0.13
120 0.14
121 0.13
122 0.13
123 0.14
124 0.15
125 0.19
126 0.19
127 0.17
128 0.16
129 0.22
130 0.23
131 0.22
132 0.22
133 0.2
134 0.2
135 0.22
136 0.22
137 0.16
138 0.15
139 0.15
140 0.15
141 0.14
142 0.14
143 0.12
144 0.11
145 0.12
146 0.18
147 0.19
148 0.2
149 0.22
150 0.22
151 0.25
152 0.25
153 0.26
154 0.2
155 0.27
156 0.26
157 0.26
158 0.29
159 0.27
160 0.27
161 0.25
162 0.29
163 0.24
164 0.25
165 0.3
166 0.26
167 0.25
168 0.29
169 0.36
170 0.33
171 0.34
172 0.35
173 0.35
174 0.34
175 0.36
176 0.32
177 0.27
178 0.27
179 0.27
180 0.31
181 0.24
182 0.26
183 0.26
184 0.33
185 0.31
186 0.32
187 0.35
188 0.29
189 0.29
190 0.29
191 0.34
192 0.3
193 0.33
194 0.35
195 0.32
196 0.36
197 0.37
198 0.43
199 0.38
200 0.43
201 0.41
202 0.39
203 0.39
204 0.43
205 0.47
206 0.41
207 0.4
208 0.38
209 0.36
210 0.34
211 0.35
212 0.29
213 0.24
214 0.29
215 0.34
216 0.29
217 0.29
218 0.34
219 0.38
220 0.39
221 0.45
222 0.44
223 0.49
224 0.57
225 0.67
226 0.71
227 0.73
228 0.75
229 0.75
230 0.79
231 0.78
232 0.79
233 0.76
234 0.72
235 0.69
236 0.64
237 0.58
238 0.51
239 0.43
240 0.33
241 0.27
242 0.23
243 0.17
244 0.17
245 0.14
246 0.12
247 0.12
248 0.11
249 0.1
250 0.08
251 0.08
252 0.09
253 0.1
254 0.12
255 0.12
256 0.11
257 0.11
258 0.13
259 0.21
260 0.2
261 0.23
262 0.24
263 0.27
264 0.32
265 0.36
266 0.37
267 0.3
268 0.33
269 0.36
270 0.42
271 0.46
272 0.44
273 0.46