Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2W8E0

Protein Details
Accession B2W8E0    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
94-122YPKINPAPKENKKEEPKKQSRTERAQTTLHydrophilic
NLS Segment(s)
PositionSequence
104-110NKKEEPK
Subcellular Location(s) cyto 10, cyto_nucl 8.833, cyto_mito 8.833, nucl 6.5, mito 6.5
Family & Domain DBs
Amino Acid Sequences MADSSVQEDLVWIQPILNKAGYKAAVAESEGTPVPKFHTWSFLEMASLEAAFGSDLAHHLVHEGLIQVDSPAPAPRQSAPPPNRAAAAAVLPGYPKINPAPKENKKEEPKKQSRTERAQTTLFGGQFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.19
4 0.2
5 0.17
6 0.16
7 0.21
8 0.2
9 0.18
10 0.18
11 0.16
12 0.14
13 0.14
14 0.16
15 0.11
16 0.13
17 0.13
18 0.13
19 0.12
20 0.12
21 0.15
22 0.15
23 0.18
24 0.16
25 0.23
26 0.23
27 0.26
28 0.27
29 0.24
30 0.21
31 0.18
32 0.18
33 0.12
34 0.1
35 0.06
36 0.04
37 0.04
38 0.04
39 0.04
40 0.03
41 0.03
42 0.03
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.05
58 0.06
59 0.06
60 0.07
61 0.09
62 0.1
63 0.16
64 0.19
65 0.29
66 0.31
67 0.37
68 0.39
69 0.38
70 0.38
71 0.32
72 0.3
73 0.21
74 0.18
75 0.12
76 0.1
77 0.09
78 0.08
79 0.09
80 0.09
81 0.08
82 0.09
83 0.13
84 0.2
85 0.22
86 0.3
87 0.41
88 0.49
89 0.58
90 0.63
91 0.68
92 0.71
93 0.79
94 0.81
95 0.82
96 0.83
97 0.84
98 0.88
99 0.89
100 0.88
101 0.88
102 0.87
103 0.84
104 0.79
105 0.72
106 0.63
107 0.57
108 0.53