Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2VRN3

Protein Details
Accession B2VRN3    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
67-93DGPVSAKKPKKVKERQREEMKVRNDKTBasic
NLS Segment(s)
PositionSequence
72-84AKKPKKVKERQRE
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
Amino Acid Sequences MTKSCTICSKPRDVLVRCQIDDTQKWHFVCPGACWKSVSGGIEDAKGMKDEYPHYRYGGMWKDRSADGPVSAKKPKKVKERQREEMKVRNDKTRESHDSAQGDEDGVVTEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.63
3 0.64
4 0.56
5 0.54
6 0.5
7 0.46
8 0.46
9 0.41
10 0.37
11 0.37
12 0.37
13 0.35
14 0.34
15 0.31
16 0.29
17 0.29
18 0.33
19 0.29
20 0.3
21 0.3
22 0.28
23 0.28
24 0.28
25 0.25
26 0.16
27 0.15
28 0.15
29 0.14
30 0.14
31 0.12
32 0.1
33 0.1
34 0.09
35 0.07
36 0.08
37 0.11
38 0.18
39 0.2
40 0.21
41 0.21
42 0.21
43 0.21
44 0.25
45 0.29
46 0.28
47 0.26
48 0.25
49 0.27
50 0.27
51 0.28
52 0.25
53 0.18
54 0.16
55 0.2
56 0.21
57 0.24
58 0.3
59 0.32
60 0.36
61 0.43
62 0.5
63 0.56
64 0.64
65 0.71
66 0.75
67 0.82
68 0.86
69 0.89
70 0.9
71 0.86
72 0.84
73 0.82
74 0.81
75 0.74
76 0.73
77 0.65
78 0.61
79 0.6
80 0.6
81 0.59
82 0.56
83 0.58
84 0.57
85 0.56
86 0.52
87 0.48
88 0.39
89 0.32
90 0.24
91 0.19