Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Y2F2

Protein Details
Accession W6Y2F2   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
96-115TPSPSVRKRKASKLKTEPAEHydrophilic
NLS Segment(s)
PositionSequence
86-90RVKPK
99-108PSVRKRKASK
Subcellular Location(s) nucl 17.5, mito_nucl 10.5, cyto 6
Family & Domain DBs
KEGG bze:COCCADRAFT_94808  -  
Amino Acid Sequences MPKWTPELDAIILHGVFEECNISFSKSLCAKIAQRVNDAGVECTPKAIENRLYSWKKKNVSGATGLNSATSTPVQTPATPKTPRSRVKPKAEDPVTPSPSVRKRKASKLKTEPAESQSEENSELDDMLAVKKMKTEPVEEGLSIDVSVEEQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.08
4 0.08
5 0.09
6 0.07
7 0.08
8 0.1
9 0.11
10 0.12
11 0.13
12 0.2
13 0.21
14 0.23
15 0.23
16 0.27
17 0.28
18 0.36
19 0.41
20 0.37
21 0.37
22 0.36
23 0.35
24 0.33
25 0.31
26 0.24
27 0.19
28 0.19
29 0.15
30 0.15
31 0.14
32 0.13
33 0.13
34 0.16
35 0.2
36 0.19
37 0.24
38 0.33
39 0.38
40 0.41
41 0.48
42 0.51
43 0.49
44 0.5
45 0.54
46 0.48
47 0.46
48 0.45
49 0.4
50 0.35
51 0.33
52 0.29
53 0.21
54 0.18
55 0.15
56 0.11
57 0.09
58 0.07
59 0.06
60 0.09
61 0.09
62 0.1
63 0.13
64 0.15
65 0.22
66 0.23
67 0.26
68 0.31
69 0.39
70 0.45
71 0.5
72 0.58
73 0.6
74 0.69
75 0.75
76 0.72
77 0.74
78 0.7
79 0.64
80 0.6
81 0.6
82 0.53
83 0.45
84 0.4
85 0.37
86 0.43
87 0.49
88 0.48
89 0.48
90 0.51
91 0.62
92 0.72
93 0.74
94 0.76
95 0.77
96 0.81
97 0.77
98 0.76
99 0.7
100 0.63
101 0.59
102 0.5
103 0.41
104 0.34
105 0.29
106 0.26
107 0.21
108 0.18
109 0.13
110 0.12
111 0.1
112 0.09
113 0.08
114 0.07
115 0.12
116 0.11
117 0.11
118 0.15
119 0.17
120 0.22
121 0.24
122 0.27
123 0.28
124 0.32
125 0.35
126 0.31
127 0.3
128 0.26
129 0.23
130 0.19
131 0.15
132 0.09