Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6XXX6

Protein Details
Accession W6XXX6    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
203-223SGDAPPSKKKNKKADVGQETFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 13.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025602  BCP1_family  
Gene Ontology GO:0005634  C:nucleus  
GO:0015031  P:protein transport  
KEGG bze:COCCADRAFT_104673  -  
Pfam View protein in Pfam  
PF13862  BCCIP  
Amino Acid Sequences MAKRKSERDPEDLPDAPEKRTQQDGDDSGSDEEMDIVNVDFEWFDPQPAVDFHGLKNLLRQLLDVDAQLFNLSELADLILSQPLLGSTVKVDGNETDPYAFLTVLNLQTHKDKKVISDLTSYLSKKASSIPTLAPLLAESSEAQVGLILTERFINMPHEVVPPMYTMLLEEIQWAVEEKEPYTFTHYLVLSKCYSEIQSQLPSGDAPPSKKKNKKADVGQETFYFHPEDEVLHKHAVGFTDFDYDTPVDEGASDSKRAFQELGVKPKGHMVLIEADKFKGAVEAVKTYLSGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.47
3 0.42
4 0.43
5 0.41
6 0.37
7 0.42
8 0.4
9 0.35
10 0.42
11 0.42
12 0.4
13 0.38
14 0.36
15 0.3
16 0.28
17 0.24
18 0.16
19 0.14
20 0.09
21 0.08
22 0.07
23 0.06
24 0.06
25 0.06
26 0.06
27 0.05
28 0.05
29 0.1
30 0.1
31 0.1
32 0.11
33 0.11
34 0.12
35 0.13
36 0.16
37 0.15
38 0.16
39 0.16
40 0.23
41 0.24
42 0.22
43 0.26
44 0.27
45 0.25
46 0.24
47 0.24
48 0.18
49 0.19
50 0.2
51 0.16
52 0.14
53 0.12
54 0.12
55 0.12
56 0.1
57 0.07
58 0.07
59 0.06
60 0.04
61 0.04
62 0.05
63 0.04
64 0.04
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.04
71 0.06
72 0.06
73 0.06
74 0.06
75 0.09
76 0.1
77 0.1
78 0.11
79 0.1
80 0.13
81 0.14
82 0.14
83 0.11
84 0.1
85 0.11
86 0.11
87 0.1
88 0.07
89 0.07
90 0.08
91 0.1
92 0.11
93 0.11
94 0.12
95 0.18
96 0.21
97 0.21
98 0.22
99 0.2
100 0.21
101 0.29
102 0.31
103 0.27
104 0.27
105 0.26
106 0.27
107 0.3
108 0.29
109 0.22
110 0.19
111 0.18
112 0.15
113 0.19
114 0.19
115 0.16
116 0.18
117 0.17
118 0.19
119 0.2
120 0.19
121 0.14
122 0.11
123 0.1
124 0.08
125 0.08
126 0.05
127 0.05
128 0.06
129 0.05
130 0.05
131 0.05
132 0.04
133 0.04
134 0.05
135 0.04
136 0.04
137 0.04
138 0.05
139 0.05
140 0.05
141 0.07
142 0.07
143 0.07
144 0.09
145 0.09
146 0.1
147 0.1
148 0.1
149 0.08
150 0.08
151 0.08
152 0.06
153 0.05
154 0.06
155 0.07
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.06
162 0.06
163 0.08
164 0.08
165 0.08
166 0.1
167 0.12
168 0.12
169 0.18
170 0.18
171 0.16
172 0.2
173 0.2
174 0.21
175 0.21
176 0.23
177 0.18
178 0.17
179 0.18
180 0.14
181 0.15
182 0.13
183 0.15
184 0.15
185 0.17
186 0.18
187 0.17
188 0.17
189 0.15
190 0.15
191 0.17
192 0.17
193 0.19
194 0.27
195 0.36
196 0.46
197 0.53
198 0.62
199 0.68
200 0.74
201 0.79
202 0.79
203 0.82
204 0.81
205 0.77
206 0.71
207 0.61
208 0.55
209 0.46
210 0.38
211 0.28
212 0.18
213 0.15
214 0.13
215 0.13
216 0.13
217 0.17
218 0.18
219 0.18
220 0.18
221 0.18
222 0.19
223 0.19
224 0.16
225 0.14
226 0.11
227 0.15
228 0.15
229 0.15
230 0.17
231 0.15
232 0.15
233 0.15
234 0.14
235 0.09
236 0.09
237 0.11
238 0.12
239 0.14
240 0.15
241 0.14
242 0.2
243 0.2
244 0.22
245 0.21
246 0.19
247 0.28
248 0.34
249 0.43
250 0.43
251 0.43
252 0.42
253 0.47
254 0.46
255 0.36
256 0.28
257 0.21
258 0.25
259 0.29
260 0.34
261 0.29
262 0.28
263 0.28
264 0.27
265 0.25
266 0.18
267 0.14
268 0.13
269 0.16
270 0.18
271 0.2
272 0.2