Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6XW88

Protein Details
Accession W6XW88   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
32-56LQDKIKILFKRRRDNKIRYSANKIYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007980  Ribosomal_VAR1  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG bze:COCCADRAFT_112710  -  
Pfam View protein in Pfam  
PF05316  VAR1  
Amino Acid Sequences SSVYSYNKSYLKSLISKDAVLNTLLRSYCNMLQDKIKILFKRRRDNKIRYSANKIYASRAELKHTNTKLFITLYLYNKQKSSIEYFLVNLRRKYLKLSNIPTYNIRLLKKLVRLQKILFNSLKLLNFNKSKFNSLNLNLRNFGLISLIEKLYNKKVEINLVELRSIHLNSDVFSSAVALKLRDRKNKAVRVLRKAILQMVRIPDLHTLITFDDNIEAMNKNNIINTIKQQVVSGVRFEASGRLTRRLTAMRAVFKYRYAGSLKNIRSSFNNKSSTMLRGYAKSNVQYTLINSKTRNGTFGLKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.42
4 0.41
5 0.4
6 0.35
7 0.3
8 0.27
9 0.2
10 0.22
11 0.21
12 0.19
13 0.18
14 0.22
15 0.24
16 0.3
17 0.31
18 0.29
19 0.34
20 0.36
21 0.4
22 0.41
23 0.44
24 0.42
25 0.49
26 0.55
27 0.59
28 0.67
29 0.71
30 0.76
31 0.79
32 0.84
33 0.85
34 0.87
35 0.88
36 0.83
37 0.83
38 0.79
39 0.78
40 0.75
41 0.65
42 0.59
43 0.52
44 0.51
45 0.49
46 0.43
47 0.41
48 0.39
49 0.43
50 0.47
51 0.47
52 0.45
53 0.39
54 0.38
55 0.35
56 0.31
57 0.27
58 0.23
59 0.25
60 0.26
61 0.31
62 0.34
63 0.33
64 0.33
65 0.34
66 0.31
67 0.28
68 0.31
69 0.27
70 0.26
71 0.25
72 0.25
73 0.3
74 0.36
75 0.37
76 0.31
77 0.32
78 0.33
79 0.32
80 0.38
81 0.38
82 0.39
83 0.44
84 0.49
85 0.53
86 0.53
87 0.54
88 0.5
89 0.47
90 0.43
91 0.39
92 0.34
93 0.28
94 0.28
95 0.31
96 0.36
97 0.38
98 0.41
99 0.41
100 0.44
101 0.43
102 0.47
103 0.45
104 0.44
105 0.38
106 0.31
107 0.28
108 0.28
109 0.27
110 0.23
111 0.22
112 0.22
113 0.25
114 0.26
115 0.3
116 0.29
117 0.32
118 0.31
119 0.32
120 0.33
121 0.32
122 0.39
123 0.35
124 0.36
125 0.32
126 0.31
127 0.28
128 0.23
129 0.19
130 0.11
131 0.08
132 0.06
133 0.07
134 0.08
135 0.08
136 0.08
137 0.1
138 0.13
139 0.15
140 0.15
141 0.16
142 0.16
143 0.2
144 0.2
145 0.23
146 0.23
147 0.22
148 0.22
149 0.19
150 0.19
151 0.16
152 0.15
153 0.11
154 0.09
155 0.09
156 0.09
157 0.1
158 0.1
159 0.08
160 0.08
161 0.09
162 0.07
163 0.09
164 0.09
165 0.08
166 0.11
167 0.2
168 0.26
169 0.34
170 0.39
171 0.46
172 0.55
173 0.62
174 0.67
175 0.69
176 0.71
177 0.71
178 0.72
179 0.64
180 0.57
181 0.51
182 0.48
183 0.41
184 0.34
185 0.29
186 0.26
187 0.25
188 0.23
189 0.23
190 0.19
191 0.17
192 0.16
193 0.13
194 0.11
195 0.1
196 0.11
197 0.1
198 0.09
199 0.08
200 0.08
201 0.08
202 0.08
203 0.08
204 0.08
205 0.1
206 0.11
207 0.11
208 0.11
209 0.14
210 0.15
211 0.16
212 0.19
213 0.22
214 0.22
215 0.22
216 0.22
217 0.23
218 0.26
219 0.25
220 0.22
221 0.18
222 0.17
223 0.17
224 0.17
225 0.17
226 0.14
227 0.19
228 0.21
229 0.26
230 0.26
231 0.27
232 0.31
233 0.31
234 0.32
235 0.33
236 0.36
237 0.38
238 0.41
239 0.45
240 0.42
241 0.4
242 0.41
243 0.35
244 0.34
245 0.3
246 0.3
247 0.32
248 0.4
249 0.41
250 0.46
251 0.45
252 0.43
253 0.45
254 0.49
255 0.51
256 0.51
257 0.53
258 0.45
259 0.48
260 0.49
261 0.47
262 0.43
263 0.39
264 0.34
265 0.32
266 0.34
267 0.37
268 0.39
269 0.39
270 0.38
271 0.34
272 0.33
273 0.31
274 0.32
275 0.36
276 0.35
277 0.36
278 0.35
279 0.39
280 0.46
281 0.45
282 0.43
283 0.36