Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Y2S8

Protein Details
Accession W6Y2S8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
31-50LGKQRRYRSKSRSGRRPASTHydrophilic
NLS Segment(s)
PositionSequence
39-42SKSR
Subcellular Location(s) mito 21.5, cyto_mito 12.5, cyto 2.5
Family & Domain DBs
KEGG bze:COCCADRAFT_94504  -  
Amino Acid Sequences MFISRCTGWVVQWAATLLFRWWKRGMFDVCLGKQRRYRSKSRSGRRPASTMCGRGAISFLYAVNRLVSRGAMEASADED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.17
4 0.12
5 0.18
6 0.17
7 0.21
8 0.22
9 0.24
10 0.25
11 0.32
12 0.34
13 0.29
14 0.35
15 0.36
16 0.36
17 0.41
18 0.42
19 0.39
20 0.4
21 0.45
22 0.49
23 0.48
24 0.55
25 0.55
26 0.64
27 0.7
28 0.75
29 0.78
30 0.77
31 0.8
32 0.75
33 0.73
34 0.63
35 0.61
36 0.56
37 0.48
38 0.4
39 0.34
40 0.3
41 0.25
42 0.24
43 0.16
44 0.12
45 0.1
46 0.09
47 0.09
48 0.09
49 0.1
50 0.11
51 0.11
52 0.11
53 0.11
54 0.11
55 0.1
56 0.11
57 0.11
58 0.1
59 0.1