Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Y292

Protein Details
Accession W6Y292   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21RDTKRRMLKERDRKKVRDGVMBasic
NLS Segment(s)
PositionSequence
9-15KERDRKK
Subcellular Location(s) mito 18, nucl 5, cyto 4
Family & Domain DBs
KEGG bze:COCCADRAFT_100620  -  
Amino Acid Sequences RDTKRRMLKERDRKKVRDGVMEKQTPSCMPGRIGPIARHGACQLSGYGRSHVLLHVFGFTCALFVRCKWVCGVVRISCPGRMEGLKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.74
4 0.74
5 0.68
6 0.65
7 0.65
8 0.65
9 0.57
10 0.5
11 0.47
12 0.36
13 0.34
14 0.27
15 0.19
16 0.17
17 0.19
18 0.21
19 0.23
20 0.25
21 0.23
22 0.25
23 0.29
24 0.28
25 0.25
26 0.22
27 0.19
28 0.17
29 0.17
30 0.12
31 0.09
32 0.1
33 0.11
34 0.11
35 0.11
36 0.11
37 0.11
38 0.11
39 0.11
40 0.09
41 0.08
42 0.1
43 0.09
44 0.09
45 0.09
46 0.08
47 0.08
48 0.08
49 0.09
50 0.07
51 0.07
52 0.16
53 0.16
54 0.17
55 0.17
56 0.24
57 0.25
58 0.29
59 0.36
60 0.32
61 0.36
62 0.41
63 0.42
64 0.38
65 0.37
66 0.34
67 0.31