Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2W195

Protein Details
Accession B2W195    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-88ILNAVPKKKTSYRKKRQRFMAGKGHydrophilic
127-151NWSIRRPTPKQAKQLKRDRRFEAIRHydrophilic
NLS Segment(s)
PositionSequence
71-82KKKTSYRKKRQR
136-146KQAKQLKRDRR
Subcellular Location(s) mito 22.5, cyto_mito 12, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MALARPLPPLWQSLFPGLNGPMRPVLSSPFLQRLSQSFNTPFGALALPSLSLPSLPSIADIWDGILNAVPKKKTSYRKKRQRFMAGKGLKDITALNTCSGCGRVKRMHILCPYCVDAIKTTIFGQLNWSIRRPTPKQAKQLKRDRRFEAIRARTMLPDPRKQKEDQVLKHTGWKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.29
4 0.27
5 0.29
6 0.25
7 0.25
8 0.22
9 0.21
10 0.22
11 0.2
12 0.21
13 0.2
14 0.21
15 0.23
16 0.27
17 0.28
18 0.28
19 0.28
20 0.28
21 0.32
22 0.32
23 0.34
24 0.29
25 0.29
26 0.3
27 0.29
28 0.26
29 0.19
30 0.17
31 0.12
32 0.1
33 0.08
34 0.07
35 0.06
36 0.07
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.07
44 0.07
45 0.07
46 0.08
47 0.07
48 0.07
49 0.07
50 0.07
51 0.06
52 0.07
53 0.08
54 0.09
55 0.12
56 0.11
57 0.12
58 0.16
59 0.24
60 0.33
61 0.43
62 0.53
63 0.62
64 0.73
65 0.82
66 0.86
67 0.87
68 0.88
69 0.84
70 0.79
71 0.78
72 0.72
73 0.62
74 0.56
75 0.47
76 0.36
77 0.29
78 0.23
79 0.14
80 0.13
81 0.13
82 0.12
83 0.11
84 0.11
85 0.11
86 0.13
87 0.12
88 0.1
89 0.15
90 0.18
91 0.21
92 0.29
93 0.3
94 0.35
95 0.4
96 0.42
97 0.38
98 0.37
99 0.37
100 0.29
101 0.27
102 0.22
103 0.16
104 0.16
105 0.15
106 0.13
107 0.12
108 0.16
109 0.16
110 0.15
111 0.18
112 0.21
113 0.26
114 0.27
115 0.29
116 0.26
117 0.29
118 0.37
119 0.37
120 0.41
121 0.47
122 0.53
123 0.62
124 0.7
125 0.77
126 0.79
127 0.86
128 0.88
129 0.86
130 0.87
131 0.82
132 0.81
133 0.76
134 0.73
135 0.73
136 0.7
137 0.66
138 0.61
139 0.57
140 0.5
141 0.49
142 0.51
143 0.47
144 0.49
145 0.51
146 0.55
147 0.58
148 0.58
149 0.63
150 0.64
151 0.67
152 0.66
153 0.67
154 0.65
155 0.62