Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6XW28

Protein Details
Accession W6XW28    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
48-80KVDKREPQKLKANRREPRKLMVDRRKPQKLKVDBasic
NLS Segment(s)
PositionSequence
46-78KLKVDKREPQKLKANRREPRKLMVDRRKPQKLK
Subcellular Location(s) mito 17, nucl 5, cyto 3
Family & Domain DBs
KEGG bze:COCCADRAFT_105097  -  
Amino Acid Sequences MRFFDVVTAAFMATSAASYPVRAARNAPAPVEGLEGIMGRNAEPQKLKVDKREPQKLKANRREPRKLMVDRRKPQKLKVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.07
4 0.07
5 0.07
6 0.09
7 0.14
8 0.16
9 0.16
10 0.18
11 0.2
12 0.27
13 0.28
14 0.27
15 0.23
16 0.22
17 0.22
18 0.22
19 0.17
20 0.09
21 0.08
22 0.08
23 0.07
24 0.06
25 0.06
26 0.04
27 0.08
28 0.09
29 0.1
30 0.11
31 0.13
32 0.19
33 0.25
34 0.27
35 0.32
36 0.4
37 0.45
38 0.53
39 0.63
40 0.61
41 0.62
42 0.7
43 0.71
44 0.74
45 0.78
46 0.79
47 0.76
48 0.82
49 0.84
50 0.78
51 0.77
52 0.76
53 0.75
54 0.75
55 0.79
56 0.8
57 0.79
58 0.86
59 0.88
60 0.83