Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YGB3

Protein Details
Accession W6YGB3   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
33-54WLLCWRCRRGRGRSRSRQDKAPHydrophilic
NLS Segment(s)
PositionSequence
41-53RGRGRSRSRQDKA
Subcellular Location(s) extr 14, mito 9, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
KEGG bze:COCCADRAFT_93230  -  
Amino Acid Sequences PFAHPRALSKNCSLLLAFGPALAAPRHASPHCWLLCWRCRRGRGRSRSRQDKAPLHTTPRRAARVRGGACACNATWTLPTAPSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.22
4 0.18
5 0.12
6 0.11
7 0.1
8 0.11
9 0.1
10 0.09
11 0.08
12 0.09
13 0.13
14 0.14
15 0.16
16 0.17
17 0.25
18 0.24
19 0.24
20 0.25
21 0.28
22 0.35
23 0.4
24 0.43
25 0.41
26 0.48
27 0.54
28 0.62
29 0.65
30 0.68
31 0.73
32 0.77
33 0.82
34 0.85
35 0.81
36 0.79
37 0.77
38 0.74
39 0.69
40 0.66
41 0.59
42 0.57
43 0.58
44 0.55
45 0.54
46 0.54
47 0.55
48 0.5
49 0.51
50 0.51
51 0.56
52 0.53
53 0.54
54 0.49
55 0.44
56 0.42
57 0.41
58 0.32
59 0.24
60 0.23
61 0.17
62 0.15
63 0.16
64 0.17