Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2W8R8

Protein Details
Accession B2W8R8    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
41-70YDRYDRCYDGRHRRRRHKSRYRHTYTETNCBasic
NLS Segment(s)
PositionSequence
51-60RHRRRRHKSR
Subcellular Location(s) nucl 21, mito 3, cyto 1.5, cyto_pero 1.5
Family & Domain DBs
Amino Acid Sequences MVAQAPMIMNGPVMASPAMITDSPMVWDDEYVDRYDRYDRYDRYDRCYDGRHRRRRHKSRYRHTYTETNCTVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.06
5 0.07
6 0.07
7 0.07
8 0.07
9 0.07
10 0.08
11 0.09
12 0.09
13 0.08
14 0.08
15 0.09
16 0.1
17 0.11
18 0.11
19 0.11
20 0.11
21 0.12
22 0.15
23 0.14
24 0.17
25 0.22
26 0.22
27 0.29
28 0.39
29 0.39
30 0.43
31 0.48
32 0.44
33 0.41
34 0.47
35 0.49
36 0.51
37 0.6
38 0.64
39 0.69
40 0.79
41 0.87
42 0.91
43 0.93
44 0.92
45 0.93
46 0.94
47 0.95
48 0.93
49 0.89
50 0.85
51 0.84
52 0.78
53 0.77