Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YAR0

Protein Details
Accession W6YAR0    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
188-208LPKTHKPITKHKKGLKFTAKKBasic
NLS Segment(s)
PositionSequence
193-207KPITKHKKGLKFTAK
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
KEGG bze:COCCADRAFT_109824  -  
Amino Acid Sequences YMMPVGTFPLLRCVPLNIPVSSNCDQEALSRTSCSREIAPRWKTDPNDIPPSSQRENSICKRDTQTPVRRFLGAMKPSKATKQSSALSWHRAAHSPTPDRPLIEPFSRDPKYAGSTKHTKAGAVVYDAHEFDPIVLPLHYHSRSQSLQHQFLQVTCRSDDEKSDGSPPQYAALDPNPFSGTAENSHDLPKTHKPITKHKKGLKFTAKKMKMNVLRVIQDIPSTAKVVHAQMNSKLNKRNRNMSVENIGLYGKLADRDGEVKKKLQDVGYISR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.3
3 0.33
4 0.27
5 0.29
6 0.29
7 0.35
8 0.34
9 0.32
10 0.25
11 0.22
12 0.21
13 0.22
14 0.26
15 0.23
16 0.22
17 0.23
18 0.23
19 0.26
20 0.27
21 0.27
22 0.26
23 0.3
24 0.37
25 0.45
26 0.5
27 0.52
28 0.55
29 0.6
30 0.57
31 0.58
32 0.59
33 0.56
34 0.6
35 0.55
36 0.55
37 0.53
38 0.57
39 0.52
40 0.45
41 0.42
42 0.37
43 0.45
44 0.48
45 0.52
46 0.46
47 0.47
48 0.5
49 0.53
50 0.57
51 0.59
52 0.62
53 0.59
54 0.65
55 0.63
56 0.58
57 0.51
58 0.49
59 0.48
60 0.45
61 0.44
62 0.39
63 0.4
64 0.41
65 0.45
66 0.44
67 0.38
68 0.35
69 0.36
70 0.35
71 0.35
72 0.42
73 0.4
74 0.4
75 0.39
76 0.37
77 0.32
78 0.33
79 0.33
80 0.31
81 0.35
82 0.35
83 0.36
84 0.38
85 0.37
86 0.35
87 0.34
88 0.32
89 0.29
90 0.26
91 0.26
92 0.23
93 0.31
94 0.31
95 0.3
96 0.27
97 0.25
98 0.27
99 0.28
100 0.28
101 0.26
102 0.32
103 0.32
104 0.37
105 0.35
106 0.31
107 0.28
108 0.27
109 0.22
110 0.16
111 0.16
112 0.12
113 0.13
114 0.14
115 0.13
116 0.11
117 0.09
118 0.08
119 0.08
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.12
126 0.12
127 0.12
128 0.13
129 0.16
130 0.17
131 0.2
132 0.27
133 0.29
134 0.31
135 0.32
136 0.34
137 0.29
138 0.3
139 0.31
140 0.24
141 0.2
142 0.17
143 0.18
144 0.17
145 0.17
146 0.17
147 0.18
148 0.18
149 0.17
150 0.2
151 0.2
152 0.19
153 0.2
154 0.19
155 0.16
156 0.15
157 0.14
158 0.13
159 0.15
160 0.17
161 0.16
162 0.17
163 0.16
164 0.15
165 0.16
166 0.14
167 0.12
168 0.12
169 0.15
170 0.15
171 0.16
172 0.17
173 0.18
174 0.18
175 0.21
176 0.26
177 0.29
178 0.34
179 0.36
180 0.39
181 0.5
182 0.6
183 0.66
184 0.68
185 0.7
186 0.74
187 0.76
188 0.81
189 0.81
190 0.79
191 0.77
192 0.79
193 0.78
194 0.73
195 0.71
196 0.71
197 0.67
198 0.64
199 0.61
200 0.55
201 0.5
202 0.47
203 0.45
204 0.36
205 0.29
206 0.24
207 0.21
208 0.17
209 0.16
210 0.14
211 0.15
212 0.16
213 0.18
214 0.23
215 0.23
216 0.25
217 0.3
218 0.38
219 0.41
220 0.45
221 0.51
222 0.53
223 0.6
224 0.63
225 0.67
226 0.65
227 0.7
228 0.68
229 0.66
230 0.64
231 0.56
232 0.5
233 0.41
234 0.34
235 0.25
236 0.21
237 0.16
238 0.11
239 0.1
240 0.1
241 0.1
242 0.12
243 0.18
244 0.25
245 0.32
246 0.34
247 0.37
248 0.41
249 0.45
250 0.48
251 0.44
252 0.44