Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Y1Z1

Protein Details
Accession W6Y1Z1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MNNGTSPFHHHRRQRRPTKNPSLTSAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 7, E.R. 5, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG bze:COCCADRAFT_40499  -  
Amino Acid Sequences MNNGTSPFHHHRRQRRPTKNPSLTSALRLPPRNHPAIVVVVIVIVFLLLRACACACMFIGYASTLSPNSAPLAHPPHADSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.86
3 0.88
4 0.91
5 0.93
6 0.92
7 0.85
8 0.79
9 0.75
10 0.65
11 0.59
12 0.52
13 0.46
14 0.42
15 0.44
16 0.41
17 0.42
18 0.46
19 0.45
20 0.4
21 0.35
22 0.31
23 0.27
24 0.25
25 0.16
26 0.1
27 0.08
28 0.07
29 0.06
30 0.04
31 0.03
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.03
38 0.03
39 0.04
40 0.04
41 0.05
42 0.05
43 0.07
44 0.08
45 0.07
46 0.08
47 0.08
48 0.08
49 0.08
50 0.09
51 0.07
52 0.08
53 0.08
54 0.08
55 0.09
56 0.1
57 0.11
58 0.16
59 0.23
60 0.24
61 0.26