Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YNE5

Protein Details
Accession W6YNE5    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28LLEKNRSCKKNKRERAKEKREERERALVBasic
NLS Segment(s)
PositionSequence
9-23KKNKRERAKEKREER
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
KEGG bze:COCCADRAFT_97347  -  
Amino Acid Sequences LLEKNRSCKKNKRERAKEKREERERALVHQNTQEPIACPSPTLPASPNQTRPDQPNPHFSHADQSMKSGKKQQRSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.94
3 0.95
4 0.95
5 0.93
6 0.94
7 0.92
8 0.87
9 0.81
10 0.79
11 0.7
12 0.64
13 0.63
14 0.54
15 0.47
16 0.45
17 0.41
18 0.32
19 0.32
20 0.27
21 0.19
22 0.19
23 0.18
24 0.14
25 0.12
26 0.12
27 0.14
28 0.14
29 0.14
30 0.12
31 0.15
32 0.22
33 0.26
34 0.32
35 0.32
36 0.35
37 0.37
38 0.42
39 0.48
40 0.5
41 0.49
42 0.53
43 0.56
44 0.58
45 0.57
46 0.51
47 0.5
48 0.46
49 0.48
50 0.38
51 0.36
52 0.39
53 0.4
54 0.43
55 0.45
56 0.47