Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6YES5

Protein Details
Accession W6YES5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
24-44FPPSHPPQHPRPQQRRPALPDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, extr 5, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
KEGG bze:COCCADRAFT_105881  -  
Amino Acid Sequences VCNLRLWFWLALRNWARLGFNICFPPSHPPQHPRPQQRRPALPDHASPDLLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.3
3 0.3
4 0.25
5 0.29
6 0.21
7 0.21
8 0.21
9 0.2
10 0.19
11 0.19
12 0.23
13 0.22
14 0.26
15 0.28
16 0.31
17 0.39
18 0.49
19 0.57
20 0.63
21 0.69
22 0.73
23 0.79
24 0.83
25 0.83
26 0.79
27 0.78
28 0.76
29 0.7
30 0.65
31 0.62
32 0.56