Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W6YBK7

Protein Details
Accession W6YBK7    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-57ERRRYEGRVQCRRPPRPCRVGKSSLCCHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 11.5, cyto_mito 7.5, nucl 7, extr 6
Family & Domain DBs
KEGG bze:COCCADRAFT_87138  -  
Amino Acid Sequences MSIESAGVSGNNPSATNGPLHCVSAASAAWERRRYEGRVQCRRPPRPCRVGKSSLCCP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.13
5 0.15
6 0.14
7 0.15
8 0.13
9 0.12
10 0.12
11 0.11
12 0.1
13 0.09
14 0.11
15 0.13
16 0.16
17 0.19
18 0.2
19 0.22
20 0.26
21 0.27
22 0.35
23 0.41
24 0.49
25 0.56
26 0.61
27 0.67
28 0.73
29 0.8
30 0.8
31 0.81
32 0.81
33 0.8
34 0.84
35 0.84
36 0.82
37 0.82
38 0.81