FuNGI

B2W7X5

Protein Details

Accession

B2W7X5

Localization Confidence

High

Confidence Score

15.4

NoLS Segment(s)

Position	Sequence	Protein Nature
41-63	LSPAELKKQKQAEKQAKRAQAKS	Hydrophilic
106-131	PNTPTAKEPEKKSKKEKEPKQTGLFF	Hydrophilic

NLS Segment(s)

Position	Sequence
46-59	LKKQKQAEKQAKRA
92-124	DKSRPLALRRRPSQPNTPTAKEPEKKSKKEKEP

Subcellular Location(s)

nucl 14, cyto_nucl 10.833, mito_nucl 8.333, cyto 6.5, plas 2

Family & Domain DBs

InterPro	View protein in InterPro IPR000649 IF-2B-related IPR042529 IF_2B-like_C IPR037171 NagB/RpiA_transferase-like
Gene Ontology	GO:0005851 C:eukaryotic translation initiation factor 2B complex GO:0032045 C:guanyl-nucleotide exchange factor complex GO:0005085 F:guanyl-nucleotide exchange factor activity GO:0003743 F:translation initiation factor activity GO:0002183 P:cytoplasmic translational initiation GO:0043547 P:positive regulation of GTPase activity GO:0006446 P:regulation of translational initiation
Pfam	View protein in Pfam PF01008 IF-2B

Amino Acid Sequences

MSEPPATEPVQPSAPPASAPAAQESASAATNAEATDAPKKLSPAELKKQKQAEKQAKRAQAKSVGGPSNQQQGPAKDGQKQQKDSKQTSKDDKSRPLALRRRPSQPNTPTAKEPEKKSKKEKEPKQTGLFFGHLYSQPKQQSLVGASKDVHPAVLALGLHTARMVAMLLVFKTVIETYQTPPGNSLARHLTSHHLGPQIEFLKSCRPLSTSMGNAIRWLKDIIIKIDPSTPENEAKRDLIEEIDIFIRERVTAADRLIRDLAATKIRAGDVVLVYAASSIVEQTIIHAHQSGKPFTVIVVDSKPLFEGKQLARKLANHGITVRYYLITGASHAVKDATKVFLGAHAMMSNGRLYSRVGTAVVSMLAHSHSLPVIVLCQSVKFTEKVALDSIVGNEVAPAEEILSEAERRDLLPLKPRLSASKDDKSTPEDAPADTSDVLKWIEDAKNLYHLQVLYDVTPAQYINMVITEYGSLPPSSVPVVHRLSTNI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.28
2	0.24
3	0.24
4	0.24
5	0.23
6	0.24
7	0.24
8	0.22
9	0.22
10	0.22
11	0.21
12	0.18
13	0.16
14	0.15
15	0.11
16	0.1
17	0.1
18	0.1
19	0.1
20	0.09
21	0.11
22	0.17
23	0.18
24	0.19
25	0.21
26	0.22
27	0.22
28	0.29
29	0.37
30	0.4
31	0.5
32	0.59
33	0.62
34	0.7
35	0.77
36	0.77
37	0.76
38	0.78
39	0.78
40	0.78
41	0.83
42	0.84
43	0.85
44	0.84
45	0.79
46	0.75
47	0.72
48	0.65
49	0.61
50	0.6
51	0.55
52	0.48
53	0.48
54	0.45
55	0.45
56	0.42
57	0.4
58	0.36
59	0.34
60	0.39
61	0.43
62	0.42
63	0.4
64	0.48
65	0.54
66	0.58
67	0.63
68	0.67
69	0.68
70	0.73
71	0.74
72	0.76
73	0.75
74	0.74
75	0.77
76	0.78
77	0.79
78	0.78
79	0.79
80	0.74
81	0.75
82	0.73
83	0.73
84	0.72
85	0.73
86	0.75
87	0.72
88	0.75
89	0.75
90	0.75
91	0.75
92	0.73
93	0.73
94	0.7
95	0.68
96	0.64
97	0.62
98	0.65
99	0.61
100	0.61
101	0.63
102	0.65
103	0.7
104	0.76
105	0.79
106	0.81
107	0.85
108	0.88
109	0.88
110	0.88
111	0.89
112	0.86
113	0.79
114	0.71
115	0.64
116	0.56
117	0.45
118	0.35
119	0.3
120	0.25
121	0.26
122	0.24
123	0.27
124	0.28
125	0.28
126	0.29
127	0.26
128	0.26
129	0.26
130	0.3
131	0.24
132	0.24
133	0.24
134	0.25
135	0.26
136	0.22
137	0.18
138	0.12
139	0.11
140	0.1
141	0.11
142	0.08
143	0.06
144	0.08
145	0.08
146	0.08
147	0.08
148	0.07
149	0.05
150	0.05
151	0.05
152	0.03
153	0.04
154	0.05
155	0.05
156	0.05
157	0.05
158	0.05
159	0.06
160	0.06
161	0.05
162	0.07
163	0.09
164	0.11
165	0.19
166	0.2
167	0.19
168	0.2
169	0.22
170	0.22
171	0.2
172	0.21
173	0.18
174	0.19
175	0.2
176	0.2
177	0.21
178	0.21
179	0.22
180	0.22
181	0.21
182	0.2
183	0.19
184	0.24
185	0.22
186	0.2
187	0.19
188	0.17
189	0.21
190	0.23
191	0.23
192	0.18
193	0.18
194	0.2
195	0.24
196	0.26
197	0.21
198	0.24
199	0.26
200	0.25
201	0.25
202	0.24
203	0.21
204	0.18
205	0.17
206	0.12
207	0.14
208	0.15
209	0.15
210	0.16
211	0.16
212	0.16
213	0.18
214	0.19
215	0.16
216	0.17
217	0.16
218	0.19
219	0.2
220	0.2
221	0.19
222	0.19
223	0.18
224	0.17
225	0.15
226	0.1
227	0.1
228	0.08
229	0.07
230	0.07
231	0.07
232	0.07
233	0.07
234	0.06
235	0.06
236	0.06
237	0.06
238	0.08
239	0.09
240	0.1
241	0.13
242	0.13
243	0.15
244	0.15
245	0.14
246	0.12
247	0.12
248	0.13
249	0.12
250	0.13
251	0.11
252	0.12
253	0.12
254	0.12
255	0.11
256	0.11
257	0.07
258	0.07
259	0.07
260	0.06
261	0.06
262	0.05
263	0.05
264	0.03
265	0.03
266	0.03
267	0.03
268	0.03
269	0.03
270	0.04
271	0.06
272	0.06
273	0.07
274	0.09
275	0.1
276	0.13
277	0.17
278	0.17
279	0.16
280	0.16
281	0.16
282	0.14
283	0.15
284	0.12
285	0.11
286	0.11
287	0.11
288	0.11
289	0.11
290	0.12
291	0.1
292	0.1
293	0.09
294	0.14
295	0.16
296	0.25
297	0.25
298	0.27
299	0.3
300	0.31
301	0.36
302	0.36
303	0.35
304	0.28
305	0.29
306	0.29
307	0.27
308	0.27
309	0.21
310	0.14
311	0.12
312	0.11
313	0.1
314	0.08
315	0.08
316	0.09
317	0.09
318	0.09
319	0.09
320	0.1
321	0.09
322	0.11
323	0.12
324	0.11
325	0.1
326	0.11
327	0.1
328	0.11
329	0.13
330	0.12
331	0.11
332	0.09
333	0.09
334	0.09
335	0.1
336	0.09
337	0.07
338	0.07
339	0.07
340	0.08
341	0.1
342	0.11
343	0.11
344	0.11
345	0.11
346	0.11
347	0.11
348	0.1
349	0.08
350	0.07
351	0.06
352	0.06
353	0.07
354	0.06
355	0.06
356	0.06
357	0.06
358	0.06
359	0.06
360	0.07
361	0.07
362	0.08
363	0.08
364	0.09
365	0.09
366	0.11
367	0.13
368	0.12
369	0.13
370	0.18
371	0.18
372	0.2
373	0.2
374	0.2
375	0.18
376	0.19
377	0.18
378	0.13
379	0.12
380	0.1
381	0.08
382	0.08
383	0.07
384	0.07
385	0.06
386	0.05
387	0.05
388	0.05
389	0.06
390	0.08
391	0.08
392	0.08
393	0.09
394	0.09
395	0.1
396	0.14
397	0.18
398	0.2
399	0.29
400	0.36
401	0.38
402	0.41
403	0.43
404	0.45
405	0.45
406	0.51
407	0.49
408	0.52
409	0.53
410	0.53
411	0.54
412	0.52
413	0.51
414	0.43
415	0.41
416	0.33
417	0.3
418	0.3
419	0.28
420	0.27
421	0.23
422	0.23
423	0.16
424	0.17
425	0.17
426	0.13
427	0.12
428	0.15
429	0.17
430	0.19
431	0.22
432	0.22
433	0.29
434	0.29
435	0.29
436	0.27
437	0.24
438	0.23
439	0.24
440	0.23
441	0.16
442	0.18
443	0.17
444	0.14
445	0.15
446	0.14
447	0.11
448	0.11
449	0.1
450	0.09
451	0.1
452	0.1
453	0.09
454	0.09
455	0.1
456	0.1
457	0.11
458	0.12
459	0.11
460	0.11
461	0.11
462	0.12
463	0.13
464	0.15
465	0.15
466	0.21
467	0.26
468	0.27

B2W7X5

3D AlphaFold-predicted Structure Viewer