Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YHI0

Protein Details
Accession W6YHI0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
224-259EETETKTPAKKPGRPKKEKKEPAKKKEPKKAATADGBasic
NLS Segment(s)
PositionSequence
230-269TPAKKPGRPKKEKKEPAKKKEPKKAATADGTPRRSGRNKA
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021331  Hva1_TUDOR  
KEGG bze:COCCADRAFT_35333  -  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MTDTEIQQGDKVSWNWGSGQPSGTVAEVKEQGELAIESNKGNTIKKNADPENPAVHVERSGNDVVKRASELQINEKAEGANSDSKQEDKKDDAEKSEEKPAESDKKEDDKPAESEKKDEEMKDAPDSEEKKEEPHTNGESKKEESNETKEDAKDDASKEESDEKSDEKSEADKEDDPKTGDKRKVEETSEKTNGADADADVEAEKPAEKKAKTDEADGEGEAKEETETKTPAKKPGRPKKEKKEPAKKKEPKKAATADGTPRRSGRNKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.27
4 0.29
5 0.26
6 0.26
7 0.23
8 0.23
9 0.23
10 0.2
11 0.18
12 0.14
13 0.17
14 0.18
15 0.18
16 0.17
17 0.16
18 0.15
19 0.15
20 0.15
21 0.12
22 0.12
23 0.12
24 0.12
25 0.12
26 0.16
27 0.17
28 0.19
29 0.22
30 0.26
31 0.31
32 0.36
33 0.44
34 0.45
35 0.5
36 0.52
37 0.52
38 0.5
39 0.45
40 0.42
41 0.35
42 0.31
43 0.27
44 0.23
45 0.19
46 0.18
47 0.19
48 0.2
49 0.19
50 0.21
51 0.2
52 0.2
53 0.21
54 0.19
55 0.19
56 0.2
57 0.22
58 0.25
59 0.32
60 0.32
61 0.3
62 0.29
63 0.26
64 0.23
65 0.21
66 0.18
67 0.17
68 0.16
69 0.18
70 0.18
71 0.2
72 0.23
73 0.24
74 0.25
75 0.22
76 0.27
77 0.31
78 0.33
79 0.34
80 0.36
81 0.37
82 0.36
83 0.41
84 0.36
85 0.3
86 0.29
87 0.32
88 0.35
89 0.33
90 0.33
91 0.3
92 0.35
93 0.36
94 0.37
95 0.35
96 0.29
97 0.31
98 0.37
99 0.39
100 0.34
101 0.35
102 0.33
103 0.35
104 0.33
105 0.3
106 0.25
107 0.21
108 0.23
109 0.22
110 0.21
111 0.18
112 0.21
113 0.22
114 0.21
115 0.21
116 0.19
117 0.19
118 0.22
119 0.25
120 0.22
121 0.25
122 0.27
123 0.29
124 0.31
125 0.32
126 0.31
127 0.29
128 0.3
129 0.26
130 0.27
131 0.25
132 0.29
133 0.28
134 0.27
135 0.28
136 0.26
137 0.26
138 0.23
139 0.21
140 0.19
141 0.17
142 0.17
143 0.17
144 0.16
145 0.16
146 0.22
147 0.2
148 0.19
149 0.2
150 0.18
151 0.18
152 0.19
153 0.18
154 0.13
155 0.15
156 0.15
157 0.16
158 0.18
159 0.19
160 0.21
161 0.24
162 0.25
163 0.24
164 0.27
165 0.31
166 0.35
167 0.38
168 0.38
169 0.39
170 0.44
171 0.47
172 0.48
173 0.51
174 0.48
175 0.52
176 0.52
177 0.49
178 0.41
179 0.38
180 0.33
181 0.25
182 0.2
183 0.11
184 0.1
185 0.09
186 0.1
187 0.08
188 0.08
189 0.08
190 0.07
191 0.09
192 0.07
193 0.11
194 0.18
195 0.18
196 0.21
197 0.28
198 0.37
199 0.38
200 0.41
201 0.41
202 0.38
203 0.4
204 0.36
205 0.31
206 0.22
207 0.2
208 0.16
209 0.13
210 0.09
211 0.09
212 0.11
213 0.13
214 0.16
215 0.19
216 0.28
217 0.31
218 0.4
219 0.48
220 0.53
221 0.61
222 0.7
223 0.77
224 0.81
225 0.88
226 0.9
227 0.92
228 0.95
229 0.95
230 0.95
231 0.95
232 0.95
233 0.95
234 0.94
235 0.93
236 0.94
237 0.93
238 0.87
239 0.85
240 0.82
241 0.79
242 0.76
243 0.72
244 0.72
245 0.71
246 0.69
247 0.63
248 0.58
249 0.58