Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YC42

Protein Details
Accession W6YC42    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
43-69VDGPKYPDKRPPPPKRPRTTPTRWKLHBasic
NLS Segment(s)
PositionSequence
50-60DKRPPPPKRPR
Subcellular Location(s) nucl 17, cyto 5.5, cyto_mito 5, mito 3.5
Family & Domain DBs
KEGG bze:COCCADRAFT_91523  -  
Amino Acid Sequences MGLVLALATHQGSRLVRFQHASDEVEQENHIPADECEIRHAPVDGPKYPDKRPPPPKRPRTTPTRWKLHAAESADDKLYTVRSSTYET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.24
4 0.26
5 0.26
6 0.29
7 0.3
8 0.3
9 0.27
10 0.27
11 0.25
12 0.23
13 0.23
14 0.17
15 0.15
16 0.12
17 0.11
18 0.08
19 0.07
20 0.12
21 0.14
22 0.13
23 0.15
24 0.16
25 0.16
26 0.16
27 0.17
28 0.12
29 0.15
30 0.18
31 0.17
32 0.21
33 0.25
34 0.29
35 0.3
36 0.37
37 0.39
38 0.46
39 0.56
40 0.62
41 0.68
42 0.76
43 0.84
44 0.85
45 0.88
46 0.84
47 0.82
48 0.82
49 0.82
50 0.8
51 0.8
52 0.74
53 0.71
54 0.67
55 0.63
56 0.6
57 0.52
58 0.46
59 0.4
60 0.4
61 0.35
62 0.32
63 0.26
64 0.21
65 0.19
66 0.16
67 0.13
68 0.12