Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6XSW6

Protein Details
Accession W6XSW6   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
98-118APPSVKKPRGRPSKKVATPKSHydrophilic
NLS Segment(s)
PositionSequence
82-89TPRKRKSK
101-112SVKKPRGRPSKK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
KEGG bze:COCCADRAFT_7334  -  
Amino Acid Sequences MDDANNPKGWTDREILSSLLYLIQKDNITLDWDGGLYAAGRTASGFKQKTNKLIRAFRPEWDAMASGAPVPQATPKKASATTPRKRKSKTDQEDGEDAPPSVKKPRGRPSKKVATPKSEDDEADLDVKAEPKEEEDEDKEIDAEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.24
4 0.22
5 0.18
6 0.18
7 0.16
8 0.13
9 0.12
10 0.15
11 0.15
12 0.15
13 0.15
14 0.12
15 0.15
16 0.14
17 0.13
18 0.1
19 0.1
20 0.1
21 0.08
22 0.08
23 0.05
24 0.04
25 0.05
26 0.04
27 0.04
28 0.05
29 0.07
30 0.09
31 0.17
32 0.18
33 0.21
34 0.29
35 0.32
36 0.41
37 0.46
38 0.51
39 0.5
40 0.57
41 0.6
42 0.62
43 0.6
44 0.53
45 0.5
46 0.44
47 0.37
48 0.3
49 0.24
50 0.15
51 0.14
52 0.12
53 0.07
54 0.07
55 0.06
56 0.05
57 0.04
58 0.09
59 0.11
60 0.12
61 0.15
62 0.16
63 0.19
64 0.2
65 0.23
66 0.29
67 0.38
68 0.45
69 0.53
70 0.6
71 0.65
72 0.67
73 0.72
74 0.72
75 0.73
76 0.72
77 0.72
78 0.69
79 0.65
80 0.65
81 0.58
82 0.49
83 0.38
84 0.3
85 0.21
86 0.17
87 0.15
88 0.17
89 0.21
90 0.26
91 0.34
92 0.45
93 0.55
94 0.63
95 0.69
96 0.74
97 0.79
98 0.81
99 0.83
100 0.8
101 0.77
102 0.75
103 0.72
104 0.68
105 0.6
106 0.52
107 0.44
108 0.38
109 0.31
110 0.27
111 0.2
112 0.15
113 0.14
114 0.16
115 0.13
116 0.13
117 0.12
118 0.13
119 0.17
120 0.19
121 0.24
122 0.25
123 0.28
124 0.28
125 0.28