Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YHY6

Protein Details
Accession W6YHY6   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
110-154ARQYYKPRPKDPREPGEQRRAIKKQRKQKEVRARLRAKKKADLKVBasic
NLS Segment(s)
PositionSequence
115-150KPRPKDPREPGEQRRAIKKQRKQKEVRARLRAKKKA
Subcellular Location(s) nucl 12.5mito_nucl 12.5, mito 11.5
Family & Domain DBs
KEGG bze:COCCADRAFT_85815  -  
Amino Acid Sequences MPLDSLFITRGSESRQTKPKVLRKPLFPLPRSIANRKTIFHAGHNPRTHSYSGRPLSATERLHVARERLRKFEQAQVKKQKRTWRTGGSDAAGVTGAVTSCIIPAPAPGARQYYKPRPKDPREPGEQRRAIKKQRKQKEVRARLRAKKKADLKVQQSILRMRMRELKNRVRLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.45
3 0.48
4 0.55
5 0.64
6 0.68
7 0.7
8 0.76
9 0.75
10 0.73
11 0.76
12 0.78
13 0.78
14 0.7
15 0.67
16 0.6
17 0.63
18 0.63
19 0.62
20 0.58
21 0.57
22 0.59
23 0.52
24 0.53
25 0.5
26 0.45
27 0.42
28 0.46
29 0.46
30 0.52
31 0.55
32 0.52
33 0.49
34 0.5
35 0.46
36 0.39
37 0.35
38 0.36
39 0.35
40 0.34
41 0.32
42 0.3
43 0.32
44 0.36
45 0.32
46 0.23
47 0.25
48 0.24
49 0.26
50 0.26
51 0.25
52 0.25
53 0.33
54 0.35
55 0.36
56 0.38
57 0.4
58 0.41
59 0.45
60 0.49
61 0.48
62 0.55
63 0.6
64 0.65
65 0.66
66 0.68
67 0.69
68 0.65
69 0.65
70 0.63
71 0.6
72 0.57
73 0.56
74 0.53
75 0.45
76 0.4
77 0.32
78 0.25
79 0.17
80 0.11
81 0.07
82 0.05
83 0.04
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.04
90 0.03
91 0.04
92 0.06
93 0.07
94 0.08
95 0.09
96 0.14
97 0.15
98 0.2
99 0.28
100 0.36
101 0.44
102 0.5
103 0.58
104 0.64
105 0.71
106 0.77
107 0.79
108 0.77
109 0.77
110 0.8
111 0.79
112 0.79
113 0.77
114 0.71
115 0.71
116 0.71
117 0.72
118 0.72
119 0.73
120 0.73
121 0.78
122 0.84
123 0.83
124 0.85
125 0.86
126 0.87
127 0.89
128 0.89
129 0.89
130 0.88
131 0.91
132 0.88
133 0.83
134 0.82
135 0.81
136 0.79
137 0.8
138 0.79
139 0.75
140 0.76
141 0.75
142 0.69
143 0.65
144 0.61
145 0.57
146 0.53
147 0.47
148 0.42
149 0.46
150 0.48
151 0.53
152 0.58
153 0.61