Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WKS2

Protein Details
Accession B2WKS2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
188-207LSAVRESKKKATRRYLFNENHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 6
Family & Domain DBs
Amino Acid Sequences MTEYINRRLSSFTLTPEAPQRTFRITALVAPTSKESPTPNLTFKKPPFLGTIRETVTFDIEHDKLPPSFRCSCLGNGNICKAPWFQEHYVVDWAAGSTLAKKEQIVHGIKMVAVKKGTLRQYVGWCAGGVGLEISETETLYSIDGIWEKIQKVPVLGRGARDVLSNEAELLFWGQWALGWIPCVLRQLSAVRESKKKATRRYLFNEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.37
4 0.41
5 0.35
6 0.36
7 0.35
8 0.35
9 0.37
10 0.35
11 0.32
12 0.27
13 0.29
14 0.3
15 0.31
16 0.26
17 0.25
18 0.28
19 0.24
20 0.24
21 0.22
22 0.2
23 0.22
24 0.28
25 0.31
26 0.35
27 0.39
28 0.43
29 0.5
30 0.5
31 0.54
32 0.48
33 0.46
34 0.45
35 0.43
36 0.44
37 0.38
38 0.41
39 0.33
40 0.33
41 0.32
42 0.26
43 0.25
44 0.19
45 0.17
46 0.16
47 0.15
48 0.14
49 0.14
50 0.16
51 0.15
52 0.19
53 0.2
54 0.22
55 0.24
56 0.25
57 0.27
58 0.27
59 0.29
60 0.31
61 0.32
62 0.32
63 0.31
64 0.32
65 0.3
66 0.27
67 0.26
68 0.21
69 0.21
70 0.19
71 0.22
72 0.2
73 0.26
74 0.27
75 0.28
76 0.29
77 0.25
78 0.22
79 0.16
80 0.15
81 0.08
82 0.07
83 0.05
84 0.04
85 0.05
86 0.06
87 0.07
88 0.07
89 0.08
90 0.1
91 0.17
92 0.18
93 0.17
94 0.18
95 0.18
96 0.18
97 0.2
98 0.19
99 0.14
100 0.12
101 0.12
102 0.13
103 0.19
104 0.21
105 0.2
106 0.21
107 0.23
108 0.26
109 0.28
110 0.28
111 0.22
112 0.19
113 0.17
114 0.15
115 0.12
116 0.08
117 0.05
118 0.04
119 0.03
120 0.03
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.05
127 0.05
128 0.05
129 0.04
130 0.05
131 0.06
132 0.07
133 0.08
134 0.11
135 0.11
136 0.14
137 0.16
138 0.16
139 0.17
140 0.19
141 0.23
142 0.27
143 0.27
144 0.27
145 0.27
146 0.27
147 0.26
148 0.25
149 0.2
150 0.17
151 0.17
152 0.16
153 0.14
154 0.12
155 0.12
156 0.11
157 0.11
158 0.08
159 0.06
160 0.06
161 0.05
162 0.06
163 0.08
164 0.09
165 0.08
166 0.09
167 0.09
168 0.11
169 0.12
170 0.15
171 0.14
172 0.13
173 0.15
174 0.18
175 0.22
176 0.28
177 0.33
178 0.36
179 0.43
180 0.47
181 0.54
182 0.59
183 0.63
184 0.66
185 0.71
186 0.75
187 0.78