Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Z060

Protein Details
Accession W6Z060   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
62-89TSARVPTPKKKIERKRHQRLRNQHHAHIBasic
96-131RQPGVWEASKKKRPKRKERERKTYTHEKAKKCHSSSBasic
NLS Segment(s)
PositionSequence
68-85TPKKKIERKRHQRLRNQH
101-118WEASKKKRPKRKERERKT
Subcellular Location(s) mito 18.5, mito_nucl 12.5, nucl 5.5
Family & Domain DBs
KEGG bze:COCCADRAFT_86684  -  
Amino Acid Sequences MILINAYSTILCCICLTPPSKCFSPLTHGPVYTFPTTSATLSQPSTLHLFLRYSSRNAPTHTSARVPTPKKKIERKRHQRLRNQHHAHILPFRTTRQPGVWEASKKKRPKRKERERKTYTHEKAKKCHSSSRLVLAPFFCSLDIPLAHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.16
3 0.19
4 0.22
5 0.26
6 0.3
7 0.31
8 0.33
9 0.34
10 0.32
11 0.36
12 0.38
13 0.41
14 0.4
15 0.39
16 0.37
17 0.38
18 0.39
19 0.33
20 0.26
21 0.2
22 0.2
23 0.2
24 0.2
25 0.19
26 0.16
27 0.17
28 0.17
29 0.18
30 0.15
31 0.15
32 0.17
33 0.16
34 0.15
35 0.14
36 0.14
37 0.13
38 0.19
39 0.19
40 0.19
41 0.22
42 0.27
43 0.28
44 0.3
45 0.33
46 0.32
47 0.33
48 0.32
49 0.3
50 0.26
51 0.29
52 0.35
53 0.35
54 0.38
55 0.44
56 0.49
57 0.55
58 0.64
59 0.69
60 0.73
61 0.79
62 0.83
63 0.86
64 0.89
65 0.9
66 0.9
67 0.9
68 0.88
69 0.88
70 0.82
71 0.74
72 0.71
73 0.63
74 0.56
75 0.5
76 0.42
77 0.34
78 0.31
79 0.29
80 0.27
81 0.27
82 0.27
83 0.24
84 0.26
85 0.25
86 0.29
87 0.33
88 0.34
89 0.41
90 0.48
91 0.54
92 0.6
93 0.67
94 0.71
95 0.76
96 0.81
97 0.85
98 0.87
99 0.9
100 0.93
101 0.95
102 0.92
103 0.89
104 0.86
105 0.86
106 0.83
107 0.82
108 0.8
109 0.76
110 0.76
111 0.79
112 0.8
113 0.73
114 0.74
115 0.68
116 0.69
117 0.66
118 0.66
119 0.61
120 0.52
121 0.51
122 0.42
123 0.4
124 0.32
125 0.28
126 0.2
127 0.15
128 0.15
129 0.17