Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YFR7

Protein Details
Accession W6YFR7   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
120-141PVSGNKRKCKHMHTTARRHGSGBasic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 10.5, nucl 7.5, mito 5
Family & Domain DBs
KEGG bze:COCCADRAFT_25581  -  
Amino Acid Sequences MFSGDYTIKKGRLDTFLDDHRLQFHPGASLVNLFAKGESCHFEMSWVISSDNPSKATFLHAFVLPPGRIKIQPIRNTLQEKVKDTAVLIGDSQPQMYGGYVRLNFGAKEPPPAQPLTLPPVSGNKRKCKHMHTTARRHGSGIPDAPTMHLPRERLKMQQPLRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.42
4 0.47
5 0.44
6 0.4
7 0.39
8 0.36
9 0.33
10 0.28
11 0.23
12 0.19
13 0.19
14 0.19
15 0.16
16 0.15
17 0.13
18 0.13
19 0.12
20 0.1
21 0.1
22 0.1
23 0.1
24 0.11
25 0.13
26 0.13
27 0.14
28 0.14
29 0.15
30 0.14
31 0.16
32 0.17
33 0.14
34 0.13
35 0.12
36 0.16
37 0.19
38 0.2
39 0.2
40 0.17
41 0.17
42 0.17
43 0.21
44 0.19
45 0.17
46 0.17
47 0.16
48 0.15
49 0.16
50 0.19
51 0.14
52 0.14
53 0.14
54 0.14
55 0.14
56 0.17
57 0.24
58 0.28
59 0.35
60 0.38
61 0.4
62 0.43
63 0.46
64 0.46
65 0.45
66 0.4
67 0.36
68 0.33
69 0.3
70 0.25
71 0.22
72 0.22
73 0.15
74 0.13
75 0.1
76 0.09
77 0.1
78 0.1
79 0.1
80 0.07
81 0.07
82 0.07
83 0.06
84 0.06
85 0.06
86 0.1
87 0.1
88 0.11
89 0.11
90 0.12
91 0.12
92 0.12
93 0.17
94 0.14
95 0.2
96 0.21
97 0.23
98 0.25
99 0.25
100 0.25
101 0.21
102 0.23
103 0.23
104 0.22
105 0.19
106 0.18
107 0.26
108 0.31
109 0.36
110 0.41
111 0.46
112 0.5
113 0.58
114 0.63
115 0.62
116 0.67
117 0.7
118 0.74
119 0.75
120 0.81
121 0.83
122 0.85
123 0.78
124 0.69
125 0.61
126 0.55
127 0.51
128 0.44
129 0.37
130 0.31
131 0.31
132 0.31
133 0.32
134 0.29
135 0.27
136 0.27
137 0.27
138 0.31
139 0.39
140 0.4
141 0.43
142 0.48
143 0.54