Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2W637

Protein Details
Accession B2W637    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-37RSASGAKRAYYRKKRAFEKGRQPANTRHydrophilic
NLS Segment(s)
PositionSequence
8-56RHKRSASGAKRAYYRKKRAFEKGRQPANTRIGTKRVHLVRTRGGNRKFR
123-145RRRQAKAGEKEEDKKKSNSVTKK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001047  Ribosomal_S8e  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
CDD cd11380  Ribosomal_S8e_like  
Amino Acid Sequences MGISRDSRHKRSASGAKRAYYRKKRAFEKGRQPANTRIGTKRVHLVRTRGGNRKFRALRLEAGNFSWGSEGIAKKTRVIGVVYHPSNNELVRTNTLTRSAIVQIDAAPFRQWYEAHYGSSLGRRRQAKAGEKEEDKKKSNSVTKKQSERLKTGGKIENAVEKQFEAGRLYAAVSSRPGQSGRCDGYVLEGEELAFYQRLLRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.65
3 0.63
4 0.68
5 0.74
6 0.75
7 0.75
8 0.77
9 0.76
10 0.79
11 0.83
12 0.86
13 0.87
14 0.86
15 0.87
16 0.86
17 0.86
18 0.83
19 0.79
20 0.77
21 0.74
22 0.7
23 0.63
24 0.57
25 0.54
26 0.5
27 0.48
28 0.47
29 0.45
30 0.45
31 0.45
32 0.46
33 0.47
34 0.55
35 0.6
36 0.61
37 0.64
38 0.66
39 0.63
40 0.68
41 0.64
42 0.58
43 0.58
44 0.51
45 0.49
46 0.46
47 0.47
48 0.38
49 0.36
50 0.33
51 0.26
52 0.23
53 0.18
54 0.12
55 0.09
56 0.11
57 0.11
58 0.12
59 0.18
60 0.19
61 0.19
62 0.21
63 0.21
64 0.19
65 0.19
66 0.18
67 0.18
68 0.25
69 0.25
70 0.24
71 0.23
72 0.23
73 0.23
74 0.21
75 0.17
76 0.11
77 0.12
78 0.14
79 0.16
80 0.16
81 0.15
82 0.17
83 0.16
84 0.14
85 0.14
86 0.13
87 0.11
88 0.1
89 0.1
90 0.08
91 0.1
92 0.1
93 0.08
94 0.07
95 0.07
96 0.07
97 0.09
98 0.08
99 0.08
100 0.15
101 0.16
102 0.16
103 0.17
104 0.17
105 0.17
106 0.23
107 0.26
108 0.21
109 0.26
110 0.28
111 0.3
112 0.35
113 0.42
114 0.45
115 0.49
116 0.54
117 0.54
118 0.56
119 0.61
120 0.63
121 0.62
122 0.56
123 0.5
124 0.47
125 0.49
126 0.53
127 0.56
128 0.57
129 0.61
130 0.66
131 0.72
132 0.76
133 0.76
134 0.73
135 0.68
136 0.66
137 0.63
138 0.57
139 0.57
140 0.56
141 0.49
142 0.45
143 0.42
144 0.43
145 0.37
146 0.35
147 0.28
148 0.22
149 0.22
150 0.21
151 0.21
152 0.15
153 0.13
154 0.13
155 0.13
156 0.13
157 0.13
158 0.12
159 0.12
160 0.13
161 0.14
162 0.15
163 0.17
164 0.18
165 0.18
166 0.22
167 0.29
168 0.3
169 0.29
170 0.29
171 0.26
172 0.3
173 0.31
174 0.28
175 0.21
176 0.17
177 0.16
178 0.15
179 0.16
180 0.13
181 0.09
182 0.08