Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6XZ14

Protein Details
Accession W6XZ14   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
30-56EYYEKGCEPRKQRRNNKRNPGSKRYSPHydrophilic
NLS Segment(s)
PositionSequence
39-52RKQRRNNKRNPGSK
Subcellular Location(s) nucl 17, mito_nucl 13.333, cyto_nucl 9.333, mito 8.5
Family & Domain DBs
KEGG bze:COCCADRAFT_98088  -  
Amino Acid Sequences STRSRCQSEVRVQYQNLRIMCTTTRYYKTEYYEKGCEPRKQRRNNKRNPGSKRYSPPTGAYARGKSFSMETMVYSATLAWSW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.59
3 0.49
4 0.42
5 0.36
6 0.31
7 0.31
8 0.28
9 0.26
10 0.26
11 0.3
12 0.29
13 0.33
14 0.35
15 0.39
16 0.42
17 0.42
18 0.41
19 0.41
20 0.41
21 0.44
22 0.46
23 0.46
24 0.47
25 0.54
26 0.58
27 0.65
28 0.74
29 0.78
30 0.83
31 0.87
32 0.9
33 0.9
34 0.9
35 0.88
36 0.86
37 0.83
38 0.8
39 0.78
40 0.73
41 0.68
42 0.61
43 0.55
44 0.52
45 0.47
46 0.45
47 0.41
48 0.4
49 0.37
50 0.36
51 0.33
52 0.29
53 0.27
54 0.23
55 0.21
56 0.17
57 0.15
58 0.15
59 0.15
60 0.14
61 0.13
62 0.11