Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6XQ91

Protein Details
Accession W6XQ91   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
115-142WVARWLKANPDCRRKKQRQQELNRIALNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 9, cyto 5.5, mito 5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006600  HTH_CenpB_DNA-bd_dom  
KEGG bze:COCCADRAFT_110880  -  
Pfam View protein in Pfam  
PF03221  HTH_Tnp_Tc5  
Amino Acid Sequences MLKRYGDYKAVEGRIQEALKALESSPKTSLAVLARQFDVPYYRLYRRARGAQSKSSRPAPNIRLNAAQDLALKAYIDRCDQLGMPALVPQLVGAAQRILDLEHPSGQAPALGKDWVARWLKANPDCRRKKQRQQELNRIALNTVEAYTAHFDALRKVLDKYVIQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.27
4 0.21
5 0.19
6 0.19
7 0.19
8 0.17
9 0.18
10 0.19
11 0.22
12 0.22
13 0.22
14 0.21
15 0.2
16 0.24
17 0.2
18 0.25
19 0.25
20 0.25
21 0.25
22 0.25
23 0.25
24 0.22
25 0.21
26 0.16
27 0.18
28 0.21
29 0.22
30 0.3
31 0.33
32 0.38
33 0.42
34 0.49
35 0.52
36 0.57
37 0.6
38 0.61
39 0.65
40 0.66
41 0.65
42 0.64
43 0.59
44 0.52
45 0.55
46 0.52
47 0.53
48 0.49
49 0.47
50 0.43
51 0.41
52 0.4
53 0.32
54 0.26
55 0.17
56 0.15
57 0.13
58 0.09
59 0.08
60 0.06
61 0.08
62 0.09
63 0.09
64 0.08
65 0.08
66 0.09
67 0.09
68 0.1
69 0.11
70 0.09
71 0.09
72 0.09
73 0.09
74 0.08
75 0.08
76 0.07
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.05
85 0.05
86 0.06
87 0.08
88 0.09
89 0.1
90 0.1
91 0.1
92 0.1
93 0.1
94 0.1
95 0.09
96 0.09
97 0.09
98 0.09
99 0.09
100 0.1
101 0.11
102 0.17
103 0.18
104 0.17
105 0.19
106 0.23
107 0.31
108 0.36
109 0.45
110 0.47
111 0.56
112 0.64
113 0.71
114 0.79
115 0.81
116 0.86
117 0.87
118 0.89
119 0.89
120 0.91
121 0.92
122 0.9
123 0.87
124 0.79
125 0.68
126 0.57
127 0.46
128 0.37
129 0.27
130 0.18
131 0.11
132 0.09
133 0.1
134 0.13
135 0.13
136 0.12
137 0.13
138 0.13
139 0.16
140 0.19
141 0.2
142 0.19
143 0.2
144 0.23
145 0.26