Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YYN9

Protein Details
Accession W6YYN9   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20LTPHGSRRPRRPTPFICFGFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 7, extr 4, cyto 2
Family & Domain DBs
KEGG bze:COCCADRAFT_87973  -  
Amino Acid Sequences LTPHGSRRPRRPTPFICFGFLYEALTSNNKTILLLPHQPIDQFGCLVADSSLETST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.74
3 0.67
4 0.57
5 0.49
6 0.43
7 0.34
8 0.27
9 0.17
10 0.16
11 0.13
12 0.14
13 0.14
14 0.1
15 0.11
16 0.09
17 0.09
18 0.09
19 0.11
20 0.14
21 0.18
22 0.19
23 0.2
24 0.21
25 0.2
26 0.21
27 0.21
28 0.18
29 0.13
30 0.12
31 0.11
32 0.1
33 0.11
34 0.1
35 0.07
36 0.07