Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6Y4I3

Protein Details
Accession W6Y4I3   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
49-69PTRILATRRTSRNRQNPNMPRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 3, nucl 2, extr 2, golg 2, cyto_pero 2
Family & Domain DBs
KEGG bze:COCCADRAFT_92865  -  
Amino Acid Sequences GFVIVIQASGLQLVPFSYQRPPRIEIGPWTKENGSLRKMCSMPRHRVFPTRILATRRTSRNRQNPNMPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.1
4 0.17
5 0.22
6 0.28
7 0.32
8 0.34
9 0.35
10 0.37
11 0.37
12 0.38
13 0.4
14 0.4
15 0.36
16 0.36
17 0.33
18 0.33
19 0.35
20 0.31
21 0.27
22 0.25
23 0.26
24 0.28
25 0.28
26 0.29
27 0.35
28 0.39
29 0.45
30 0.47
31 0.52
32 0.5
33 0.57
34 0.57
35 0.53
36 0.52
37 0.49
38 0.49
39 0.47
40 0.49
41 0.48
42 0.54
43 0.56
44 0.58
45 0.61
46 0.67
47 0.74
48 0.8
49 0.82