Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6YHF7

Protein Details
Accession W6YHF7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-48ASSEPGSVRSKRKRRLRRPWLRSQPPPPARSHydrophilic
NLS Segment(s)
PositionSequence
24-41SVRSKRKRRLRRPWLRSQ
Subcellular Location(s) mito 13, nucl 8, cyto_nucl 7.5, cyto 5
Family & Domain DBs
KEGG bze:COCCADRAFT_103086  -  
Amino Acid Sequences GLKKSVWQCSRPRRASWASSEPGSVRSKRKRRLRRPWLRSQPPPPARSNVVILQPPIDSPKPGLHPPRRSLLCPCAVCLSLSHPIPSRLLPLFPTTALPPSLCCCRSRLAFNVRAVVPSPPFAPVVTPLPALLRRCVARLPPTTHHRPLTTSTTTAATPATAMF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.69
3 0.67
4 0.64
5 0.57
6 0.53
7 0.51
8 0.43
9 0.42
10 0.41
11 0.38
12 0.39
13 0.46
14 0.55
15 0.63
16 0.73
17 0.79
18 0.84
19 0.9
20 0.92
21 0.93
22 0.92
23 0.93
24 0.94
25 0.92
26 0.89
27 0.86
28 0.86
29 0.82
30 0.78
31 0.7
32 0.64
33 0.57
34 0.51
35 0.46
36 0.38
37 0.34
38 0.31
39 0.28
40 0.24
41 0.21
42 0.19
43 0.19
44 0.16
45 0.13
46 0.13
47 0.17
48 0.19
49 0.24
50 0.33
51 0.38
52 0.44
53 0.47
54 0.53
55 0.51
56 0.5
57 0.49
58 0.45
59 0.44
60 0.37
61 0.35
62 0.29
63 0.27
64 0.25
65 0.2
66 0.18
67 0.15
68 0.15
69 0.15
70 0.14
71 0.15
72 0.16
73 0.16
74 0.16
75 0.12
76 0.12
77 0.12
78 0.13
79 0.13
80 0.12
81 0.13
82 0.11
83 0.12
84 0.12
85 0.11
86 0.1
87 0.12
88 0.17
89 0.17
90 0.17
91 0.17
92 0.2
93 0.23
94 0.26
95 0.31
96 0.34
97 0.39
98 0.4
99 0.44
100 0.4
101 0.38
102 0.35
103 0.3
104 0.23
105 0.18
106 0.17
107 0.13
108 0.13
109 0.12
110 0.12
111 0.13
112 0.15
113 0.15
114 0.15
115 0.14
116 0.17
117 0.21
118 0.22
119 0.21
120 0.22
121 0.22
122 0.23
123 0.26
124 0.28
125 0.32
126 0.38
127 0.43
128 0.47
129 0.54
130 0.6
131 0.64
132 0.64
133 0.58
134 0.54
135 0.52
136 0.52
137 0.47
138 0.4
139 0.35
140 0.33
141 0.31
142 0.28
143 0.23
144 0.15