Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W6XZZ7

Protein Details
Accession W6XZZ7    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSFIRLLLHREKKAKRRAKWGSIFELHydrophilic
NLS Segment(s)
PositionSequence
10-19REKKAKRRAK
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
KEGG bze:COCCADRAFT_9305  -  
Amino Acid Sequences MSFIRLLLHREKKAKRRAKWGSIFELPSFAKGPPLQDVRGLIHLKPPEILPADVLRNMEKNELRLDETVELIAISTRTSNSTGVKGNEANKLYKLSMEADESDDLAYETTSKYLAVTKEMKLYGIEGLDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.8
4 0.83
5 0.84
6 0.85
7 0.81
8 0.78
9 0.74
10 0.69
11 0.58
12 0.53
13 0.43
14 0.35
15 0.3
16 0.22
17 0.21
18 0.19
19 0.2
20 0.21
21 0.24
22 0.23
23 0.23
24 0.25
25 0.23
26 0.29
27 0.28
28 0.22
29 0.24
30 0.24
31 0.23
32 0.22
33 0.2
34 0.17
35 0.17
36 0.17
37 0.13
38 0.14
39 0.15
40 0.16
41 0.16
42 0.14
43 0.13
44 0.14
45 0.17
46 0.15
47 0.15
48 0.16
49 0.16
50 0.17
51 0.16
52 0.16
53 0.12
54 0.12
55 0.1
56 0.08
57 0.07
58 0.05
59 0.05
60 0.04
61 0.03
62 0.04
63 0.04
64 0.06
65 0.07
66 0.09
67 0.1
68 0.13
69 0.17
70 0.17
71 0.2
72 0.21
73 0.23
74 0.27
75 0.28
76 0.27
77 0.24
78 0.26
79 0.23
80 0.21
81 0.2
82 0.17
83 0.16
84 0.17
85 0.17
86 0.17
87 0.17
88 0.17
89 0.15
90 0.12
91 0.11
92 0.09
93 0.08
94 0.06
95 0.06
96 0.06
97 0.06
98 0.06
99 0.07
100 0.11
101 0.12
102 0.18
103 0.21
104 0.23
105 0.29
106 0.29
107 0.29
108 0.26
109 0.26
110 0.22