Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A061H9Y4

Protein Details
Accession A0A061H9Y4    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
63-88AKRHVAGARRRSTRNKRNTACRMVAAHydrophilic
NLS Segment(s)
PositionSequence
64-78KRHVAGARRRSTRNK
Subcellular Location(s) mito 14.5, nucl 11.5, cyto_mito 8.333, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR028847  CENP-W  
IPR009072  Histone-fold  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0051382  P:kinetochore assembly  
GO:0000278  P:mitotic cell cycle  
KEGG pfp:PFL1_03638  -  
Pfam View protein in Pfam  
PF15510  CENP-W  
Amino Acid Sequences MKLPPRSLVKRLIRSHLPASARLSKNADLYIALAFLLYMQRLANETRLTHQIDLSNGIRGPLAKRHVAGARRRSTRNKRNTACRMVAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.61
3 0.58
4 0.5
5 0.44
6 0.45
7 0.48
8 0.43
9 0.41
10 0.42
11 0.37
12 0.37
13 0.34
14 0.28
15 0.18
16 0.17
17 0.14
18 0.1
19 0.08
20 0.05
21 0.05
22 0.05
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.06
29 0.07
30 0.09
31 0.09
32 0.1
33 0.12
34 0.16
35 0.17
36 0.16
37 0.17
38 0.16
39 0.16
40 0.2
41 0.18
42 0.17
43 0.15
44 0.15
45 0.14
46 0.13
47 0.15
48 0.17
49 0.2
50 0.19
51 0.2
52 0.24
53 0.3
54 0.36
55 0.43
56 0.47
57 0.52
58 0.57
59 0.63
60 0.7
61 0.75
62 0.78
63 0.81
64 0.82
65 0.81
66 0.86
67 0.89
68 0.87