Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A061H552

Protein Details
Accession A0A061H552    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
190-212LSSLSKAQRKKLNKRRRLEEEAAHydrophilic
NLS Segment(s)
PositionSequence
92-94KRK
196-208AQRKKLNKRRRLE
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007823  RRP8  
IPR042036  RRP8_N  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
GO:0006364  P:rRNA processing  
KEGG pfp:PFL1_06885  -  
Pfam View protein in Pfam  
PF05148  Methyltransf_8  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MPDLDLGALQAQLELNRSVLADSIMSKFSSLGASSSSSSSPSKNGASATAQPPRSATLGVGATPKGKQATLAANGKPSSIEDVKLKGRLLAKRKRHDEPAQGDEESEGDEEEGRAALVGSSSKRKSGKAAAAATGSNSAADGSNAPSSSKSSNKKNSKDPFAVKGAAFQKQQQQQQAASKIIVDGKEVDLSSLSKAQRKKLNKRRRLEEEAAKRAAQHEDGEETKAAAASSTLTPLQSQMLNRLTGSRFRTINEQLYTTDSASALSSFTADPSIFDDYHKGFRSQVKSWPKNPLDILCSSLLAAKKPKAGTKPAKSQHTGQVKARYGACPLVIDLGAGEGMLARKLVKDGHFKVLSFDLVNTADGWVRKADTATIGALPLPGFYDASDPLSLRGAAPPGSAQGQADIAIFCLSLMGTNWLSMILEASRCLRVGAELLVAEVSSRFVSVEGFVSLVEKVGFKLEGRDDTNTHFVVFEFVKLDPASSARRREAGDDHLTESRLVELGSSLLKPCLYKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.12
4 0.12
5 0.11
6 0.11
7 0.11
8 0.1
9 0.11
10 0.13
11 0.14
12 0.14
13 0.14
14 0.14
15 0.14
16 0.15
17 0.13
18 0.11
19 0.12
20 0.14
21 0.15
22 0.17
23 0.17
24 0.18
25 0.19
26 0.2
27 0.21
28 0.23
29 0.24
30 0.24
31 0.24
32 0.24
33 0.27
34 0.32
35 0.36
36 0.4
37 0.39
38 0.37
39 0.38
40 0.37
41 0.34
42 0.27
43 0.2
44 0.18
45 0.18
46 0.19
47 0.2
48 0.19
49 0.19
50 0.19
51 0.22
52 0.18
53 0.17
54 0.17
55 0.19
56 0.25
57 0.31
58 0.36
59 0.35
60 0.38
61 0.38
62 0.37
63 0.33
64 0.27
65 0.27
66 0.22
67 0.23
68 0.21
69 0.26
70 0.3
71 0.33
72 0.32
73 0.29
74 0.34
75 0.4
76 0.47
77 0.51
78 0.58
79 0.65
80 0.72
81 0.73
82 0.76
83 0.77
84 0.77
85 0.74
86 0.7
87 0.64
88 0.57
89 0.51
90 0.42
91 0.34
92 0.25
93 0.17
94 0.1
95 0.07
96 0.07
97 0.07
98 0.07
99 0.06
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.07
106 0.1
107 0.17
108 0.18
109 0.24
110 0.26
111 0.27
112 0.32
113 0.38
114 0.42
115 0.43
116 0.45
117 0.42
118 0.41
119 0.4
120 0.35
121 0.29
122 0.21
123 0.13
124 0.1
125 0.08
126 0.07
127 0.07
128 0.07
129 0.08
130 0.1
131 0.1
132 0.11
133 0.11
134 0.13
135 0.17
136 0.24
137 0.29
138 0.36
139 0.47
140 0.56
141 0.61
142 0.69
143 0.73
144 0.74
145 0.75
146 0.7
147 0.65
148 0.59
149 0.57
150 0.46
151 0.45
152 0.4
153 0.37
154 0.34
155 0.31
156 0.35
157 0.38
158 0.43
159 0.41
160 0.4
161 0.39
162 0.45
163 0.46
164 0.39
165 0.32
166 0.28
167 0.24
168 0.24
169 0.2
170 0.14
171 0.12
172 0.11
173 0.13
174 0.12
175 0.11
176 0.1
177 0.1
178 0.1
179 0.14
180 0.15
181 0.18
182 0.21
183 0.28
184 0.35
185 0.45
186 0.55
187 0.61
188 0.7
189 0.75
190 0.81
191 0.84
192 0.84
193 0.83
194 0.79
195 0.78
196 0.76
197 0.73
198 0.66
199 0.57
200 0.48
201 0.41
202 0.35
203 0.27
204 0.18
205 0.13
206 0.14
207 0.14
208 0.16
209 0.14
210 0.12
211 0.11
212 0.1
213 0.09
214 0.06
215 0.05
216 0.05
217 0.06
218 0.07
219 0.07
220 0.07
221 0.07
222 0.08
223 0.09
224 0.09
225 0.09
226 0.13
227 0.15
228 0.15
229 0.15
230 0.18
231 0.18
232 0.21
233 0.24
234 0.22
235 0.21
236 0.21
237 0.27
238 0.27
239 0.32
240 0.28
241 0.26
242 0.23
243 0.25
244 0.25
245 0.19
246 0.17
247 0.11
248 0.1
249 0.09
250 0.09
251 0.06
252 0.05
253 0.05
254 0.05
255 0.05
256 0.06
257 0.05
258 0.05
259 0.07
260 0.1
261 0.09
262 0.1
263 0.12
264 0.13
265 0.19
266 0.19
267 0.18
268 0.18
269 0.24
270 0.29
271 0.29
272 0.36
273 0.42
274 0.47
275 0.5
276 0.57
277 0.53
278 0.51
279 0.5
280 0.44
281 0.36
282 0.31
283 0.3
284 0.2
285 0.19
286 0.16
287 0.17
288 0.15
289 0.14
290 0.16
291 0.16
292 0.19
293 0.21
294 0.26
295 0.27
296 0.36
297 0.44
298 0.48
299 0.56
300 0.59
301 0.63
302 0.62
303 0.61
304 0.6
305 0.59
306 0.56
307 0.51
308 0.53
309 0.49
310 0.49
311 0.47
312 0.39
313 0.32
314 0.29
315 0.24
316 0.15
317 0.14
318 0.12
319 0.1
320 0.09
321 0.07
322 0.06
323 0.05
324 0.04
325 0.04
326 0.03
327 0.04
328 0.04
329 0.04
330 0.04
331 0.05
332 0.06
333 0.1
334 0.14
335 0.22
336 0.26
337 0.34
338 0.35
339 0.35
340 0.36
341 0.35
342 0.31
343 0.23
344 0.2
345 0.14
346 0.13
347 0.13
348 0.11
349 0.1
350 0.11
351 0.11
352 0.12
353 0.1
354 0.1
355 0.1
356 0.11
357 0.11
358 0.1
359 0.11
360 0.11
361 0.11
362 0.1
363 0.1
364 0.1
365 0.09
366 0.08
367 0.07
368 0.06
369 0.06
370 0.06
371 0.08
372 0.09
373 0.11
374 0.12
375 0.11
376 0.12
377 0.13
378 0.13
379 0.11
380 0.12
381 0.12
382 0.11
383 0.11
384 0.11
385 0.11
386 0.13
387 0.13
388 0.11
389 0.1
390 0.1
391 0.1
392 0.11
393 0.09
394 0.08
395 0.07
396 0.07
397 0.06
398 0.06
399 0.05
400 0.05
401 0.05
402 0.08
403 0.09
404 0.09
405 0.09
406 0.09
407 0.09
408 0.09
409 0.09
410 0.07
411 0.07
412 0.08
413 0.11
414 0.12
415 0.12
416 0.12
417 0.11
418 0.1
419 0.12
420 0.12
421 0.11
422 0.1
423 0.1
424 0.1
425 0.09
426 0.09
427 0.07
428 0.07
429 0.06
430 0.06
431 0.06
432 0.06
433 0.07
434 0.08
435 0.09
436 0.09
437 0.09
438 0.08
439 0.09
440 0.09
441 0.09
442 0.09
443 0.08
444 0.08
445 0.1
446 0.11
447 0.1
448 0.16
449 0.19
450 0.25
451 0.28
452 0.31
453 0.31
454 0.35
455 0.4
456 0.34
457 0.3
458 0.25
459 0.21
460 0.22
461 0.21
462 0.18
463 0.14
464 0.14
465 0.17
466 0.17
467 0.18
468 0.14
469 0.17
470 0.24
471 0.29
472 0.35
473 0.35
474 0.4
475 0.41
476 0.44
477 0.46
478 0.46
479 0.47
480 0.43
481 0.44
482 0.43
483 0.42
484 0.38
485 0.33
486 0.26
487 0.18
488 0.16
489 0.12
490 0.09
491 0.1
492 0.12
493 0.13
494 0.12
495 0.14
496 0.15
497 0.17