Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A061H250

Protein Details
Accession A0A061H250   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
114-139ENGSVRSGSRRNRRPDQARRRETEAGHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, extr 11, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
KEGG pfp:PFL1_06535  -  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLGLAADGFKAITNRVSGSVCLTATVACVAYYTVWALVMPFLPADAMVQELFPDRIWAVRAPSLILVVGLGSVGIFIGLTIRGDVGSEADPAYARPVSHRARANDVRQDPSELENGSVRSGSRRNRRPDQARRRETEAGQSQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.17
4 0.16
5 0.18
6 0.2
7 0.17
8 0.16
9 0.15
10 0.13
11 0.12
12 0.12
13 0.09
14 0.06
15 0.06
16 0.06
17 0.06
18 0.07
19 0.06
20 0.06
21 0.05
22 0.05
23 0.05
24 0.06
25 0.06
26 0.05
27 0.05
28 0.05
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.04
35 0.04
36 0.05
37 0.06
38 0.07
39 0.06
40 0.07
41 0.06
42 0.07
43 0.08
44 0.09
45 0.1
46 0.11
47 0.12
48 0.11
49 0.11
50 0.11
51 0.09
52 0.08
53 0.06
54 0.04
55 0.03
56 0.03
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.01
63 0.01
64 0.02
65 0.02
66 0.02
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.05
73 0.05
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.09
80 0.08
81 0.08
82 0.1
83 0.17
84 0.21
85 0.27
86 0.33
87 0.33
88 0.42
89 0.49
90 0.52
91 0.54
92 0.54
93 0.52
94 0.47
95 0.48
96 0.4
97 0.35
98 0.33
99 0.24
100 0.22
101 0.2
102 0.19
103 0.17
104 0.16
105 0.15
106 0.17
107 0.23
108 0.31
109 0.39
110 0.47
111 0.56
112 0.65
113 0.75
114 0.81
115 0.85
116 0.88
117 0.88
118 0.89
119 0.86
120 0.84
121 0.8
122 0.71
123 0.7