Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A061H1W8

Protein Details
Accession A0A061H1W8    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
61-86NQYRECKKAWTNQRRTDRLNNRPGAFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 12.833, cyto 8, cyto_pero 4.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
KEGG pfp:PFL1_05642  -  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSSSQPPQQPDDYSKPEDFVKVMGGKTPSKFTDPCAKAAKQSMKCLDDNNYDRTKCGEVFNQYRECKKAWTNQRRTDRLNNRPGAFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.44
3 0.41
4 0.38
5 0.31
6 0.23
7 0.21
8 0.18
9 0.18
10 0.19
11 0.21
12 0.23
13 0.24
14 0.27
15 0.24
16 0.25
17 0.26
18 0.26
19 0.33
20 0.32
21 0.36
22 0.37
23 0.36
24 0.34
25 0.41
26 0.46
27 0.39
28 0.43
29 0.42
30 0.39
31 0.4
32 0.39
33 0.36
34 0.35
35 0.35
36 0.35
37 0.35
38 0.32
39 0.32
40 0.33
41 0.31
42 0.24
43 0.24
44 0.23
45 0.26
46 0.31
47 0.37
48 0.43
49 0.43
50 0.45
51 0.45
52 0.41
53 0.39
54 0.39
55 0.43
56 0.46
57 0.55
58 0.62
59 0.69
60 0.79
61 0.81
62 0.82
63 0.84
64 0.83
65 0.82
66 0.82
67 0.8