Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A061H721

Protein Details
Accession A0A061H721    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
127-146APVKQESKPKPKPAPRPALSHydrophilic
NLS Segment(s)
PositionSequence
127-169APVKQESKPKPKPAPRPALSLPKPAPKPAPKPAPAPSKSAPKK
Subcellular Location(s) extr 25
Family & Domain DBs
KEGG pfp:PFL1_04235  -  
Amino Acid Sequences MKLSLTPALVLVLLGLTSLSVSAAPIRRDVGQNTLQDGSANAQGGSSTSIANNGQGGQYSDNSAQGGVVNQTSGSGVTTSDDFDVPPPPPPAPAPVEKPEAPKEDAEKHDESWNDDEDEDDRKPEPAPVKQESKPKPKPAPRPALSLPKPAPKPAPKPAPAPSKSAPKKDPVGDTLGGLTSGIIAPSKPNAAKAPPKSSAISGNAPGSKPLTSGLLNGEKASSGAGGHKSALGVTSGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.04
9 0.09
10 0.14
11 0.15
12 0.17
13 0.19
14 0.22
15 0.25
16 0.27
17 0.28
18 0.3
19 0.31
20 0.33
21 0.32
22 0.29
23 0.26
24 0.24
25 0.2
26 0.17
27 0.15
28 0.12
29 0.11
30 0.1
31 0.11
32 0.12
33 0.1
34 0.08
35 0.07
36 0.1
37 0.1
38 0.11
39 0.11
40 0.1
41 0.09
42 0.09
43 0.11
44 0.11
45 0.11
46 0.13
47 0.13
48 0.14
49 0.13
50 0.12
51 0.11
52 0.09
53 0.1
54 0.08
55 0.07
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.05
63 0.05
64 0.05
65 0.06
66 0.07
67 0.07
68 0.07
69 0.07
70 0.08
71 0.1
72 0.1
73 0.13
74 0.14
75 0.13
76 0.14
77 0.15
78 0.18
79 0.19
80 0.22
81 0.23
82 0.25
83 0.3
84 0.3
85 0.34
86 0.34
87 0.34
88 0.32
89 0.28
90 0.28
91 0.3
92 0.3
93 0.32
94 0.29
95 0.27
96 0.28
97 0.28
98 0.27
99 0.23
100 0.22
101 0.17
102 0.16
103 0.14
104 0.12
105 0.15
106 0.12
107 0.11
108 0.1
109 0.1
110 0.11
111 0.14
112 0.17
113 0.17
114 0.23
115 0.27
116 0.32
117 0.36
118 0.45
119 0.5
120 0.56
121 0.6
122 0.62
123 0.68
124 0.71
125 0.77
126 0.78
127 0.8
128 0.72
129 0.72
130 0.68
131 0.69
132 0.62
133 0.59
134 0.53
135 0.5
136 0.49
137 0.44
138 0.48
139 0.45
140 0.49
141 0.5
142 0.56
143 0.52
144 0.55
145 0.6
146 0.63
147 0.57
148 0.57
149 0.52
150 0.54
151 0.56
152 0.59
153 0.54
154 0.49
155 0.53
156 0.51
157 0.51
158 0.42
159 0.42
160 0.35
161 0.32
162 0.27
163 0.22
164 0.17
165 0.13
166 0.1
167 0.06
168 0.05
169 0.05
170 0.05
171 0.04
172 0.06
173 0.08
174 0.12
175 0.12
176 0.15
177 0.18
178 0.25
179 0.34
180 0.4
181 0.46
182 0.45
183 0.48
184 0.46
185 0.45
186 0.45
187 0.4
188 0.37
189 0.33
190 0.34
191 0.34
192 0.32
193 0.32
194 0.27
195 0.23
196 0.2
197 0.18
198 0.16
199 0.14
200 0.16
201 0.2
202 0.24
203 0.24
204 0.24
205 0.23
206 0.2
207 0.19
208 0.19
209 0.13
210 0.08
211 0.12
212 0.14
213 0.15
214 0.15
215 0.16
216 0.16
217 0.15
218 0.15