Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A061H8V6

Protein Details
Accession A0A061H8V6    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
68-88SGSASTSIKVKPKKRKIKKDEHydrophilic
NLS Segment(s)
PositionSequence
76-87KVKPKKRKIKKD
Subcellular Location(s) mito 13.5, mito_nucl 13.333, nucl 12, cyto_nucl 7.333
Family & Domain DBs
KEGG pfp:PFL1_03758  -  
Amino Acid Sequences MATSSSRGAGRSWTKEEVIKLFHMVYERKPLSAKAAAEMLGRTEMSCTLKVVNLHKVIEDLVGQWAESGSASTSIKVKPKKRKIKKDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.43
4 0.39
5 0.34
6 0.29
7 0.26
8 0.23
9 0.22
10 0.22
11 0.21
12 0.2
13 0.26
14 0.26
15 0.25
16 0.26
17 0.25
18 0.27
19 0.29
20 0.27
21 0.18
22 0.19
23 0.18
24 0.18
25 0.17
26 0.13
27 0.09
28 0.08
29 0.07
30 0.06
31 0.07
32 0.09
33 0.09
34 0.09
35 0.09
36 0.11
37 0.14
38 0.16
39 0.2
40 0.21
41 0.21
42 0.21
43 0.2
44 0.19
45 0.17
46 0.14
47 0.09
48 0.08
49 0.08
50 0.08
51 0.07
52 0.07
53 0.06
54 0.06
55 0.06
56 0.05
57 0.08
58 0.08
59 0.09
60 0.13
61 0.16
62 0.25
63 0.33
64 0.42
65 0.5
66 0.61
67 0.72
68 0.8