Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A061HFV3

Protein Details
Accession A0A061HFV3    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-32VNVPKTRRTYCKGKPCKKHTQHKITQYKTGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pfp:PFL1_02710  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRRTYCKGKPCKKHTQHKITQYKTGKASLYAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECVACKYRSHMALKRCKHFELGGDKKQKNAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.85
4 0.9
5 0.9
6 0.91
7 0.9
8 0.9
9 0.89
10 0.89
11 0.9
12 0.83
13 0.83
14 0.77
15 0.71
16 0.63
17 0.58
18 0.48
19 0.39
20 0.39
21 0.36
22 0.39
23 0.38
24 0.42
25 0.46
26 0.48
27 0.52
28 0.56
29 0.56
30 0.57
31 0.61
32 0.61
33 0.61
34 0.61
35 0.61
36 0.59
37 0.59
38 0.5
39 0.45
40 0.41
41 0.33
42 0.35
43 0.37
44 0.35
45 0.3
46 0.37
47 0.41
48 0.5
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.66
57 0.6
58 0.57
59 0.54
60 0.48
61 0.42
62 0.38
63 0.32
64 0.28
65 0.27
66 0.29
67 0.31
68 0.37
69 0.4
70 0.45
71 0.54
72 0.61
73 0.66
74 0.65
75 0.61
76 0.57
77 0.53
78 0.51
79 0.52
80 0.53
81 0.54
82 0.59
83 0.58
84 0.58
85 0.61
86 0.56