Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A061H929

Protein Details
Accession A0A061H929    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
81-104LDLRAKKTRAIRRKLTKHEAKAVTHydrophilic
NLS Segment(s)
PositionSequence
74-112KGKKHIPLDLRAKKTRAIRRKLTKHEAKAVTERQHKKNI
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG pfp:PFL1_03421  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAKVKAFELQSKSKADLTSQLEELKTELLQLRVQKVAGGNSSKLTKINTVRKNIARVLTVINQKQRANLREFYKGKKHIPLDLRAKKTRAIRRKLTKHEAKAVTERQHKKNIHFGNRKFVLKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.35
3 0.37
4 0.35
5 0.34
6 0.33
7 0.33
8 0.29
9 0.28
10 0.27
11 0.21
12 0.15
13 0.13
14 0.13
15 0.12
16 0.15
17 0.18
18 0.2
19 0.2
20 0.2
21 0.19
22 0.19
23 0.19
24 0.2
25 0.2
26 0.18
27 0.19
28 0.2
29 0.19
30 0.19
31 0.18
32 0.2
33 0.26
34 0.35
35 0.38
36 0.42
37 0.48
38 0.5
39 0.52
40 0.49
41 0.43
42 0.34
43 0.29
44 0.27
45 0.26
46 0.28
47 0.27
48 0.28
49 0.29
50 0.29
51 0.32
52 0.34
53 0.33
54 0.32
55 0.35
56 0.35
57 0.41
58 0.43
59 0.44
60 0.48
61 0.49
62 0.48
63 0.5
64 0.49
65 0.46
66 0.48
67 0.52
68 0.54
69 0.57
70 0.61
71 0.58
72 0.58
73 0.56
74 0.6
75 0.62
76 0.61
77 0.61
78 0.64
79 0.71
80 0.79
81 0.84
82 0.85
83 0.85
84 0.82
85 0.83
86 0.77
87 0.71
88 0.69
89 0.67
90 0.66
91 0.66
92 0.68
93 0.65
94 0.7
95 0.69
96 0.66
97 0.69
98 0.7
99 0.71
100 0.73
101 0.7
102 0.71
103 0.74